KEGG   Mus musculus (mouse): 69583Help
Entry
69583             CDS       T01002                                 

Gene name
Tnfsf13, 2310026N09Rik, April, Tall2, Tnlg7b, Trdl1
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 13
  KO
K05475  tumor necrosis factor ligand superfamily member 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04672  Intestinal immune network for IgA production
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    69583 (Tnfsf13)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    69583 (Tnfsf13)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    69583 (Tnfsf13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    69583 (Tnfsf13)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    69583 (Tnfsf13)
   04090 CD molecules [BR:mmu04090]
    69583 (Tnfsf13)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     69583 (Tnfsf13)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   69583 (Tnfsf13)
CD molecules [BR:mmu04090]
 Proteins
  69583 (Tnfsf13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF LapA_dom
Motif
Other DBs
NCBI-GeneID: 69583
NCBI-ProteinID: NP_076006
MGI: 1916833
Ensembl: ENSMUSG00000089669
Vega: OTTMUSG00000006001
UniProt: Q9D777 Q5F2A4
Structure
PDB: 

Position
11; 11 B3
AA seq 241 aa AA seqDB search
MPASSPGHMGGSVREPALSVALWLSWGAVLGAVTCAVALLIQQTELQSLRREVSRLQRSG
GPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKA
DSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGR
RETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVK
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgccagcctcatctccaggccacatggggggctcagtcagagagccagccctttcggtt
gctctttggttgagttggggggcagttctgggggctgtgacttgtgctgtcgcactactg
atccaacagacagagctgcaaagcctaaggcgggaggtgagccggctgcagcggagtgga
gggccttcccagaagcagggagagcgcccatggcagagcctctgggagcagagtcctgat
gtcctggaagcctggaaggatggggcgaaatctcggagaaggagagcagtactcacccag
aagcacaagaagaagcactcagtcctgcatcttgttccagttaacattacctccaaggca
gactctgacgtgacagaggtgatgtggcaaccagtacttaggcgtgggagaggcctggag
gcccagggagacattgtacgagtctgggacactggaatttatctgctctatagtcaggtc
ctgtttcatgatgtgactttcacaatgggtcaggtggtatctcgggaaggacaagggaga
agagaaactctattccgatgtatcagaagtatgccttctgatcctgaccgtgcctacaat
agctgctacagtgcaggtgtctttcatttacatcaaggggatattatcactgtcaaaatt
ccacgggcaaacgcaaaacttagcctttctccgcatggaacattcctggggtttgtgaaa
ctatga

DBGET integrated database retrieval system