KEGG   Mus musculus (house mouse): 69587
Entry
69587             CDS       T01002                                 
Symbol
Pcgf3, 2310035N15Rik, AI662857, D630042K08Rik, DONG1, E430039C14, RNF3A, Rnf3
Name
(RefSeq) polycomb group ring finger 3
  KO
K11488  polycomb group RING finger protein 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    69587 (Pcgf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69587 (Pcgf3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     69587 (Pcgf3)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX zf-C3HC4_4 zf-Nse zf-RING_4 zf-RING_10 GAGA Prok-RING_4
Other DBs
NCBI-GeneID: 69587
NCBI-ProteinID: NP_766304
MGI: 1916837
Ensembl: ENSMUSG00000033623
UniProt: Q8BTQ0
Position
5:108609082..108654842
AA seq 241 aa
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIH
QSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLD
PRNGETKADDNSNKETAEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQAT
VLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDL
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttgaccaggaagattaaactctgggatataaatgcccacatcacctgccgcctgtgc
agcggctacctcattgacgcaaccacagtgactgagtgtttgcacacattctgcaggagc
tgcctggtgaagtatctggaggagaataatacctgccccacctgcaggatcgtgatccat
cagagccacccattacagtatatcggtcatgacagaaccatgcaggacattgtttacaag
ctggtgccaggcctccaggaagcggaaatgaggaaacagagggaattctatcacaaactg
ggcatggaggtaccaggtgacatcaagggggaggcgtgctcagcaaaacagcacttagat
ccccgaaatggtgaaaccaaagcagacgacaattcaaataaagagacagcagaggagaag
caggaggaggacaatgactaccacaggagtgacgagcaggtaagcatctgtctggaatgc
aacagcagcaaactacgtggcctcaagcggaagtggatcagatgctcagcccaagcaact
gtgctgcacctgaaaaaatttatcgccaagaagcttaacctctcctcctttaatgagctg
gacattttatgcaatgaggagatcctgggcaaggaccacactctcaagttcgtggttgtt
acaagatggagattcaagaaggcacccctcctgctacactacagacccaagatggacttg
ctgtaa

DBGET integrated database retrieval system