KEGG   Mus musculus (mouse): 69590
Entry
69590             CDS       T01002                                 

Gene name
Gpx8, 2310016C16Rik, AU017063
Definition
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    69590 (Gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    69590 (Gpx8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    69590 (Gpx8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    69590 (Gpx8)
   05016 Huntington disease
    69590 (Gpx8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     69590 (Gpx8)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 69590
NCBI-ProteinID: NP_081403
MGI: 1916840
Ensembl: ENSMUSG00000021760
UniProt: Q9D7B7
Position
13; 13 D2.2
AA seq 209 aa
MEPFAAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRTNSFYSFEVKDAKGRTV
SLEKFKGKASLVVNVASDCRFTDKSYQTLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK
EVESFARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPLEAIRPHVSQMIGQIILKKKEDL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggagcctttcgctgcctacccattaaaatgttccgggcccaaagcaaagatatttgca
gttttgctctctatggttctgtgcaccgtgatgctttttctccttcagttaaaattcctg
aagccgagaaccaacagcttctactcctttgaagtaaaggatgccaaaggaaggaccgtg
tctctggaaaagttcaaaggcaaagcttccctggttgtaaacgtggctagtgactgccgc
ttcacagacaagagttaccagactctcagggagctacacaaggagttcgggccctatcac
ttcaacgtcctggcttttccgtgcaatcagtttggagaatcggagcccaagtccagcaag
gaggtagaatcttttgcgagacagaactacggagtcacattccccatcttccacaagatt
aagattttagggccggaagcagaacctgcgtttagatttattgttgattcttccaagaag
gagccaaggtggaatttttggaagtatctggtcaaccctgagggacaagtcgtgaagttc
tggaggccagaagaaccccttgaagccatcagacctcatgtatcacaaatgattgggcaa
attattcttaaaaagaaagaggatctatga

DBGET integrated database retrieval system