KEGG   Mus musculus (mouse): 69611
Entry
69611             CDS       T01002                                 

Gene name
Lce1d, 2310037L11Rik, AI415320, Sprrl7
Definition
(RefSeq) late cornified envelope 1D
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LCE SPRR2
Other DBs
NCBI-GeneID: 69611
NCBI-ProteinID: NP_081413
MGI: 1916861
Ensembl: ENSMUSG00000103243
Vega: OTTMUSG00000051851
UniProt: Q9D731
Position
3; 3 F1
AA seq 133 aa
MSCQQSQQQCQPPPKCTPKCPPKCQTPKCPPKCPPKCPPKCPPVSSCCSLGSGGCCGSSS
GGCCSSGGCCSSGGCCSSGGGGCCLSHHRPHRSLRRHRHSSGCCSSGGSSGCCGSSGGSS
GCCGSSQQSGDCC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgtcctgccagcaaagccaacagcagtgccagcctcctcccaagtgcacccccaagtgc
cctcccaagtgccagaccccgaagtgccctccaaaatgcccccctaagtgtcctcccaaa
tgcccccctgtgtcttcctgctgtagcctgggttctgggggctgctgtggctccagctct
ggtggttgctgcagctctggtggctgctgcagttctggaggctgctgcagctctgggggt
ggaggctgctgcctgagccaccacaggcctcacagatctcttcgtcgccatcgccacagc
tctggatgctgtagcagtggtggcagcagtggctgctgtggcagcagtggtggcagcagt
ggctgctgtggcagtagccaacagtctggggactgctgctga

DBGET integrated database retrieval system