KEGG   Mus musculus (house mouse): 69632
Entry
69632             CDS       T01002                                 
Symbol
Arhgef12, 2310014B11Rik, AU019857, Larg, mKIAA0382
Name
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04360  Axon guidance
mmu04611  Platelet activation
mmu04625  C-type lectin receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    69632 (Arhgef12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    69632 (Arhgef12)
   04625 C-type lectin receptor signaling pathway
    69632 (Arhgef12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    69632 (Arhgef12)
  09158 Development and regeneration
   04360 Axon guidance
    69632 (Arhgef12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    69632 (Arhgef12)
   05205 Proteoglycans in cancer
    69632 (Arhgef12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    69632 (Arhgef12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    69632 (Arhgef12)
   05152 Tuberculosis
    69632 (Arhgef12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69632 (Arhgef12)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    69632 (Arhgef12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 Peptidase_M50 Ribonuc_2-5A AAA_23
Other DBs
NCBI-GeneID: 69632
NCBI-ProteinID: NP_001346161
MGI: 1916882
Ensembl: ENSMUSG00000059495
Position
9:complement(42875138..43017069)
AA seq 1543 aa
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSSSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIRSGSYVALTVQGRPPGSPQIPLADSEVEPSVTGHMSPIMTSPHSPG
AAGNMERITSPVLVGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVIAPSRPLGDALTLSEAEADPGDGLCRTDWSSGDAS
RPSSDSADSPKSSLRERSYLEEAPERSEGVQDAEPQSLVGSPSTRGAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVPVPEEISVDLEKRRPELIPEDLHRLYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRGTLEKERACAEQIVTKIEEVLMTAQAVEEER
SSTMQYVILMYMKYLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMEIQKSRHPKHLSTPSSVSPEPQDPAKLRQSGVANEGTDTGY
LPASSMSSATSGTALSQEGGRENDTGTKQVGEASAPGDCLDSTPRVPTTVFDFPPPLLDQ
VQEEECEVERVAEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHVGLNEQMKAVRKRNETSVIDHIGEDLLIWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFHTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEREKV
KKAADHCRQILNYVNQAVREAENKQRLEDYQRRLDTSNLKLSEYPNVDELRNLDLTKRKM
IHEGPLVWKVNRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQPPPCEGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSLNTP
GKSAAEHLFVTATQFAKEQHANGALKEGDGGYPVTIPGPHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSTQEDWQSFSRYGPASEEVQADSGIRDLENVKACHAREGQMSFKTGTG
DIATCDSPRTSTESCAAQDSVILASQDSQASNVLVMDHMILTPEMPPAEPEGGLDESGEH
FFDAREAHSDDNPSEGDGAVKKEEKDVNLRISGNCLILDGYDAVQESSTDEEVASSFPLQ
PVTGIPAVDSSHQQQHSPQNVHPEGPVSPFTPEFLVQRHWRAMEDTCFEIQSPSCTDSQS
QILEYIHKIEADLEHLKKVEESYALLCQRLAGSALPDKLSDKS
NT seq 4632 nt   +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcacggacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaaacagaaagttgaacgcagttca
tcgcatgattttgaccccacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatctatggtcttgttcagcgctgtgtgatcatccagaaagacgacaat
ggcttcgggctgacagtcagtggagacaatccggtcttcgtacaatctgtcaaagaagat
ggagcagccatgcgtgctggagtacaaacaggtgatcgaatcatcaaggtgaatggtact
ctggtgactcattcaaatcatctggaggtggtgaaactaatcagatctggttcctatgta
gctctcactgtccagggacgcccacctgggtcgccccagatcccacttgctgattctgaa
gtagagccatcagtcactggacatatgtctcccattatgacatcccctcattcccctgga
gcagccgggaatatggagagaatcaccagtcctgtgctcgtgggggaggaaaacaatgtg
gtccataaccagaaagtagagattctgagaaagatgttacagaaggaacaggaacggctg
cagttgctgcaggaagattacaaccgaacggctacccaaagattgctcaaggagatccag
gaggccaagaagcacatcccgcagctgcaggagcagctgtccaaagccacgggctctgct
caggacggagctgtaattgcaccctccaggccattaggtgatgccctaacactcagtgag
gcagaagcagatcctggagatggcctgtgcaggactgactggagcagtggagatgcttct
cggcccagtagtgacagtgctgatagtcccaagagtagcctgagagaaaggagttacctg
gaggaagccccagagagaagtgaaggagttcaggacgctgagccgcagtcgctggtcggc
agtccctccacccggggcgcccctcacatcattggagcagaggatgatgattttggtact
gagcatgagcagatcaatggacagtgcagctgtttccagagcattgaattgctgaagtct
cgccctgctcacttggctgttttcttacaccatgtagtctcacagtttgaccctgcaaca
ttgctctgttatctctattcagacctgtataagcagacaaactccaaggagactcggcgt
gtcttcctggagtttcatcagttcttcttggaccggtctgcacacctgaaggttccagtt
cctgaggaaatctccgtggatctagaaaagagaagacctgagcttattcctgaggatctg
catcgcctctacattcagacaatgcaggagagagtccaccctgaagttcagaggcacttg
gaggatttccgacagaaacgcagcatggggctgaccttggctgagagtgagctgactaaa
cttgatgcagagagagacaaggaccggggaactctggagaaggagcgagcatgtgcggaa
cagatcgttaccaaaattgaagaagtgttgatgactgctcaggctgtagaagaagaaagg
agttccacaatgcagtatgtaattctcatgtatatgaagtatttgggagtaaaagtgaaa
gaacctcgaaacttggagcacaagcggggtcggatcggcttccttccaaagatcaagcaa
agcatgaagaaagatagagagggcgaagaaaaagggaagcgaagaggattccccagcatt
ttgggacccccaagaagaccaagccgccacgacaacagtgcaattggcagggccatggag
atacagaagtcacgccacccgaagcacttatccactccctcgtctgtgagtcctgagcct
caggaccctgccaagttgcgccagagtggagtagccaatgaaggaacagacactggatac
ctgcccgccagttccatgtcctctgccacctcagggactgctctttcccaagagggaggg
agagagaatgatacaggaacaaaacaagtgggagaagcatcggcgcctggagactgcttg
gacagcacacctcgagtccccactactgttttcgacttccctcctcctctattagatcaa
gtgcaggaggaggagtgtgaagtagagagggtggcagaacatgggaccccaaaacccttt
cggaagtttgacagcatcgcctttggagaaagtcagagtgaggatgagcagtttgaaaat
gacctggagacagatccacccaactggcagcagcttgttagcagagaagtgttactggga
ctgaaaccttctgagatcaaaagacaggaagtgattaatgaattgttctacactgagaga
gctcatgtccggacactgaaggttcttgaccaagtattctatcagcgagtgtccagagaa
gggattctatcaccttcagaactacgcaagattttttcaaacttggaagatatccttcaa
cttcatgttgggttgaatgagcaaatgaaagctgtccgaaaaaggaatgaaacttctgtt
attgatcatattggggaagatctgctcatctggtttagtggaccaggagaggagaagctg
aaacatgctgctgccacattctgcagtaaccaacctttcgccctggaaatgatcaagtct
cgccagaaaaaggattctcgattccatacttttgtgcaagacgctgagagtaaccccctg
tgccgtcgtcttcagctgaaggacatcattcccacccaaatgcagagactcactaagtac
ccgcttcttttggataacattgccaagtacacagaatggcctccagaaagggaaaaggtg
aagaaggctgcagaccattgtcgtcagatcttaaattatgtaaatcaggctgtcagggag
gcagaaaacaagcagcgcttagaagactatcagcgtcgccttgacacctccaatctcaag
ttgtccgagtacccaaatgttgacgagctcaggaatttggatttaacaaaaagaaagatg
attcatgaagggccgttggtctggaaggtgaatagagataaaagcatcgatctttataca
ctgctgctggaagacatccttgtgctgctacagaagcaggatgacaggctggtgctaagg
tgccacagcaagattctggcatccacagccgacagcaaacacaccttcagccctgtcatt
aagctgagcacggtgctggttcggcaggtggcgacagataacaaagctttattcgtcatc
tccatgtcagataatggagcccaaatttatgaattggtagcacagacggtttctgaaaag
acagtctggcaagacctcatctgtcgaatggctgcgtcagtgaaggagcagtctacaaag
ccgattcccctcccacagccgccaccttgcgaaggagacaatgatgaagaagaaccagcc
aagttaaaagtggagcaccatgatctttcagtcgctggtctgcaaagtccagacagagtt
ttgggattagaatctcccttaatttcgtcaaagcctcagtctcattcactgaatacccct
ggcaaatcagcggcagaacatctctttgtgaccgcaacacagtttgcaaaggaacagcat
gcaaatggggcactcaaggaaggtgatggcgggtatccagtcacaatcccaggtccacac
ttgcctgtgtcagaggagcggtgggcattggacgcactgagaaatttgggcttgttgaag
cagttgctggtacagcagttaggtctcaccgagaagagtactcaggaagactggcagtcc
ttctcacgatacgggccagcttctgaagaggtacaggcagacagtggcatccgggacttg
gaaaatgttaaggcttgtcatgccagggaaggacagatgtcttttaaaactggaactggt
gatattgcaacttgtgacagtccacggacttcaactgagtcttgtgctgcacaggattca
gtgatactggcatcccaagacagccaggcaagtaacgttttagtaatggaccacatgatc
ctgaccccagagatgcctcctgcagagccagaagggggtctggatgagagtggagagcac
ttttttgatgcccgtgaagcacatagtgatgataatccatcagaaggtgatggagcagtt
aaaaaggaagagaaggatgttaatttacgcatctcaggaaactgtttgatccttgatggc
tatgatgcagttcaggagagctccacagatgaggaggttgcctcctcgttccccctgcag
cctgtgacgggcatccccgctgtggactccagccaccagcagcaacattcccctcagaat
gtgcatcccgaggggccggtttcaccattcaccccagaattcctggtccagcggcactgg
cgagctatggaggatacctgttttgagatccagagtccctcatgtacagattcacaaagc
caaatcctggagtacattcataaaatagaggctgacctggaacacttaaagaaggtggag
gaaagttacgctcttctttgccaaaggctggctggctcagccctccccgacaagctctca
gataaaagttag

DBGET integrated database retrieval system