KEGG   Mus musculus (mouse): 69654
Entry
69654             CDS       T01002                                 

Gene name
Dctn2, 2310042E05Rik, C130077D06Rik, C87049, DCTN-5, DCTN-50, GMP23-48K, RBP, RBP50, p5, p50
Definition
(RefSeq) dynactin 2
  KO
K10424  dynactin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    69654 (Dctn2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    69654 (Dctn2)
   05016 Huntington disease
    69654 (Dctn2)
   05022 Pathways of neurodegeneration - multiple diseases
    69654 (Dctn2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    69654 (Dctn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69654 (Dctn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    69654 (Dctn2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     69654 (Dctn2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     69654 (Dctn2)
SSDB
Motif
Pfam: Dynamitin DUF2408 PI_PP_I ZapB Sec34
Other DBs
NCBI-GeneID: 69654
NCBI-ProteinID: NP_081427
MGI: 107733
Ensembl: ENSMUSG00000025410
UniProt: Q99KJ8 Q3TPZ5
Position
10 D3; 10 74.5 cM
AA seq 402 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELSSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGDYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLADPDGALAKRLLLQ
LEATKSSKGSSGGKATAGAPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVR
CDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKAS
VEDADTQNKVHQLYETIQRWSPVASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQM
MASSLKDNTALLTQVQTTMRENLATVEGNFASIDARMKRLGK
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgatctccccggcattgccaggaatgagccagacgtttat
gaaaccagcgacctacctgaggatgatcaagcagagtttgatgcggaggaactgagcagc
acaagcgtggaacacatcattgtcaaccccaacgctgcctacgacaagttcaaggacaag
agagtgggaacaaaggggcttgatttctcagatcgcattggaaagaccaagaggacagga
tatgagtctggagactatgaaatgcttggagagggtctgggagtgaaggagacaccgcag
cagaagtaccaacgactactgcatgaagtccaagagctgacaactgaggtggagaagatc
aagacgacagtgaaggagtcagccaccgaggagaagctcacccctgtggtgctggctaag
cagctggctgccctgaagcagcagctggtggcttcccacctggagaagcttctgggacca
gatgctgcaatcaaccttgccgacccagacggagccctagctaagcgcttactgctgcag
ctggaagcaactaagagcagcaaaggcagttcagggggtaaggctacagctggggccccc
ccagacagcagcctggtcacctatgaactccactcacggcctgagcaggacaagttctct
caagctgccaaagttgcagaactcgagaagcgtctgacagagctggaggccactgtccga
tgtgaccaggatgctcagaatcccctttctgcaggtctacagggagcctgccttatggaa
acggtagaactgttgcaagccaaagtgagtgccctggaccttgcagttctggaccaagta
gaggctcggcttcagagtgtcctgggaaaggtgaatgagattgctaagcacaaggcatcc
gtggaggacgcagacactcagaacaaggtgcaccagctctatgagaccatccagcgctgg
agcccagtcgcctccaccctccctgaactggtacagcgacttgtcaccatcaagcagctg
catgagcaagctatgcagtttggtcagctcctgacacacttggataccacccagcagatg
atggccagttcccttaaggataatactgctctcctgacccaggtgcagacaacgatgcgt
gaaaacttggccacagttgaggggaactttgccagcattgatgctcggatgaagaggctg
ggaaagtga

DBGET integrated database retrieval system