KEGG   Mus musculus (mouse): 69655Help
Entry
69655             CDS       T01002                                 

Gene name
Cd164l2, 2310047N01Rik
Definition
(RefSeq) CD164 sialomucin-like 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MGC-24 DUF4366
Motif
Other DBs
NCBI-GeneID: 69655
NCBI-ProteinID: NP_081428
MGI: 1916905
Ensembl: ENSMUSG00000028865
Vega: OTTMUSG00000010478
UniProt: Q9D6W7 Q3TYL8
Position
4; 4 D2.3
AA seq 172 aa AA seqDB search
MAAPGPRALRAALCGGCCCLLLCAQLVLAGKGARGFGRGALLRLNVWPTTQGGCKHLGHC
EHCVDRAHNFSICVWQQCGPEEPGHCVAQAEVVKEGCSIYNHSESCPASHHHSTEEPKPS
TTGSPPIPEDHSPGFDGASFIGGIVLVLSLQATAFFVLRFLKAKDSTYQTLI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacccggaccccgcgccttgcgtgctgctctctgcggcggttgttgttgcctt
ctcctgtgtgcccagctggttctagctggtaaaggagctcgtggctttggtcggggagcc
ctgctccgcctgaacgtttggcctactacccaagggggctgcaaacacctgggacactgt
gaacactgtgtggacagagcccacaacttctccatttgtgtctggcagcaatgtgggcca
gaggagccaggacactgtgtggcccaagctgaagtggtcaaggagggttgctcaatctat
aaccactcagagtcatgcccagcttcccatcatcattccacagaggaaccgaagccaagt
accacagggagtccccccatccctgaagaccacagcccaggttttgatggagctagcttc
attgggggcatcgtgctggtactgagcctgcaagcaacagctttctttgtgcttcgcttc
ctcaaggccaaggacagcacttaccagacactaatctga

DBGET integrated database retrieval system