KEGG   Mus musculus (mouse): 69662
Entry
69662             CDS       T01002                                 

Gene name
2310061I04Rik
Definition
(RefSeq) RIKEN cDNA 2310061I04 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF2358
Other DBs
NCBI-GeneID: 69662
NCBI-ProteinID: NP_001028802
MGI: 1916912
Ensembl: ENSMUSG00000050705
Vega: OTTMUSG00000033080
UniProt: B8JJ69
Position
17; 17 B1
AA seq 315 aa
MYRPSPGAARRLGPCLRAYQARPQDQLSPRPLPFPPLWPHSTPPTSPSFPPHRSLPPSHP
PTHHLPQAPPPPLSQAQALNSLSMVLPPRKREKGPGPELHSGCLDGLRSLFEGPPCPYPG
AVIPFQAPGPSHSSPTTPSGDESMEEHLAVMHERLRQELPTLFLRSHDYTIYSMDVEFIN
EILNIRTKGRTFYVMSLTLCRFLVWNYFAQFRLEILQLTRHPENWTLQARWRLIGLPIHM
LFLRFYRRDKEDLYRTFDAFSTFYLNSSGLICRHHLDKLMPSHSPSTPVKKLLVGALVAL
GLSEPEPSLHLCSKA
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtaccgtccgagcccgggggccgcccggcgcctcgggccctgcctccgcgcctaccag
gcgcgaccccaggaccagctctctcctcgacctctaccattccccccgctctggccccac
tccactccaccgacttctccatcttttcctcctcaccggtcactaccaccctcacatcct
cctacccaccatcttccccaggctcctccaccacctctctctcaggcccaggctctcaac
tcattgagtatggttcttcctccgagaaagagggagaagggaccaggaccggaactacac
agtggttgcctggatgggcttaggagcctttttgagggaccgccttgcccctatcctggg
gctgtgatacctttccaagcccctggaccttcccactcttcccccaccactccatcagga
gatgagagtatggaggaacacctggctgtcatgcatgagagactaagacaagagcttccc
accctcttccttcgctcccatgactacactatatattcaatggatgtggaattcatcaat
gagatcctgaacattcgtaccaagggccggacattttatgttatgtccctgaccctttgc
cgcttcctggtttggaactattttgcacagtttcggttggagattttacagctgacccgc
caccctgagaactggaccctgcaagcccgctggcgtctaataggtctgcccatacatatg
ctcttcctgcgtttctacaggcgtgataaagaggatctttaccggaccttcgatgccttt
tccaccttctacctgaattccagtggcctcatctgtcgccatcacctggacaagctgatg
ccttcacactcaccgtcgacgcctgtgaaaaagctgctggtgggagccctggtggccctg
gggctgtcagaaccagagcccagcttacacctgtgctccaaggcctga

DBGET integrated database retrieval system