KEGG   Mus musculus (mouse): 69675
Entry
69675             CDS       T01002                                 

Symbol
Pxdn, 2310075M15Rik, C85409, E330004E07, VPO1, mKIAA0230
Name
(RefSeq) peroxidasin
  KO
K19511  peroxidase [EC:1.11.1.7]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    69675 (Pxdn)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     69675 (Pxdn)
SSDB
Motif
Pfam: An_peroxidase I-set Ig_3 Ig_2 LRR_8 ig V-set C2-set_2 Ig_5 LRR_4 LRR_9 LRR_5 Ig_4 Ig_6 VWC Ig_C17orf99 PSP94 LRRCT rOmpB Amnionless
Other DBs
NCBI-GeneID: 69675
NCBI-ProteinID: NP_852060
MGI: 1916925
Ensembl: ENSMUSG00000020674
Vega: OTTMUSG00000027521
UniProt: Q3UQ28
Position
12; 12 A2
AA seq 1475 aa
MAVRPTRRCLLALLLCFAWWAMAVVASKQGAGCPSRCLCFRTTVRCMHLLLEAVPAVAPQ
TSILDLRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFEDLENLKYLYLYKNEIQ
SIDRQAFKGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQLES
MKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAAATCEYPRRIQGRSVATITPEELNC
ERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLM
IQNTQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLEC
SATGHPLPQITWTRGDRTPLPIDPRVNITPSGGLYIQNVAQSDSGEYTCFASNSVDSIHA
TAFIIVQALPQFTVTPQSRVVIEGQTVDFQCAAKGHPQPVIAWTKGGSQLSVDRRHLVLS
SGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQ
LPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGTADAGRYECVARNTIGYA
SVSMVLSVNVPDVSRNGDPYVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLALFRY
PRDPYTVGQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLSLIANLSGC
TAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINS
QRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSD
GQHCSSVCSNDPPCFSVMIPPNDPRVRSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQI
NQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDE
NESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKIVG
AEIQHITYRHWLPKILGEVGMKMLGEYRGYDPSVNAGIFNAFATAAFRFGHTLINPLLYR
LDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRIPSQLLNTELTERL
FSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIKSPVIREKLQR
LYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYENPGVFSPAQLT
QLKQTSLARILCDNSDNITRVQQDVFRVAEFPHGYSSCEDIPRVDLRVWQDCCEDCRTRG
QFNAFSYHFRGRRSLEFSYEDDKPTKRARWRKALSVKHGKHLSNATSATHEHLEGPATND
LKEFVLEMQKIITDLRKQINSLESRLSTTECVDDSGESHGGNTKWKKDPCTVCECKNGQI
TCFVEACQPAACPQPVKVEGACCPVCLKNTAEEKP
NT seq 4428 nt   +upstreamnt  +downstreamnt
atggccgtgcgccccacgcgccgctgcctgctggcgctcctgctgtgctttgcctggtgg
gccatggcggtggtcgcctcgaagcaaggggcaggctgtccaagccgctgcctgtgtttc
cgtaccaccgtgcgctgcatgcatctgttgctggaggccgtgcccgccgtggcgccgcag
acctccatcctagatcttcggttcaacagaatcagagagatccaacccggggcattcagg
aggctgaggagcctgaacacactgcttcttaacaacaaccagatcaagaagatccccaat
ggtgcatttgaggacctggagaacttaaaatacctctatttgtacaagaatgagatccaa
tcaattgacaggcaagcatttaagggacttgcctctctagagcaactgtacctgcacttt
aatcagatagaaacgctggaccctgaatccttccagcacctgccaaagctggagagactg
tttttgcacaacaaccgtatcacgcacttagttcctgggacgttcagtcagttagagtcc
atgaaacggctgcgattggactcgaatgcactccactgtgactgtgaaatcctatggcta
gcggatctactgaagacctacgcccaatctggaaacgcacaagcagcagctacatgcgag
tatcccagacgcatccaaggacgctctgtggctaccatcaccccagaagagctgaactgt
gaaaggccccggattacctcagagccacaggatgcagatgtcacctcagggaacacagtg
tacttcacctgcagagctgagggcaaccccaaacctgagatcatctggcttcgaaacaat
aacgagttgagcatgaagacggactctcgcttaaacttgctggacgatggcacgctgatg
attcagaacacacaggaggcggatgagggtgtctaccagtgcatggcgaaaaatgtggct
ggagaggcgaaaacgcaggaggtgaccctcaggtacttggggtctccagcccgacccact
tttgtaatccagccgcagaacacagaggtactggtgggtgagagtgtcactctggagtgc
agtgccacaggccaccctctgcctcagatcacctggacaagaggtgaccgcacacccttg
ccaattgaccctcgagtgaatatcactccctctggaggactgtatatacagaacgtcgcc
cagagtgacagcggcgagtacacgtgctttgcatccaatagtgtggacagtatccatgcc
acagccttcatcattgtacaagcccttcctcagttcactgtgaccccacagagccgagtg
gtcattgaagggcagactgtggatttccagtgtgcggctaagggacaccctcagcctgtc
atagcctggaccaagggagggagccagctctcagtggacaggcggcacctggtgctgtcc
tcaggaacactcaggatttctggggtggccctgcatgaccagggccagtatgagtgccag
gccgtcaatatcattggctcccagaaggtcgtggcccacctgacagtacagcctagagtc
accccggtatttgccagcattcccagtgacatgactgtagaggtgggcaccaacgtgcag
ctgccttgtagctcccagggagaaccagagccagccatcacctggaacaaggatggtgtt
caggtaacagaaagtggaaaatttcacatcagccccgaaggattcttgaccatcaatgat
gttggcactgccgatgcaggtcgctatgagtgtgtagctcggaacacaattggatatgcc
tctgtgagcatggtactcagtgtgaatgttcctgatgtaagtcggaatggggatccctat
gttgctacctctattgttgaagccattgcaactgttgacagagccatcaactctacaagg
acacacttgtttgacagccgtcctcgttctccaaatgacctgctcgctctgttccggtac
ccacgggatccatacacagtgggacaagccagggcaggagagatattcgagcggaccctg
cagctgatccaggagcatgttcagcatggcttgatggtggacttgaatggaacaagttac
cactacaatgatctggtgtccccgcagtacctgagcctcatcgccaacctgtcaggctgc
actgcacaccgccgcgtgaacaactgctcagacatgtgcttccaccagaagtataggacg
cacgatggcacgtgcaacaatctacagcacccgatgtggggtgcctcactgaccgccttt
gagcgcctgttgaaggctgtgtatgagaatgggttcaacacaccccggggcattaattcc
cagcgtcagtacaatgggcatgtactacccatgccccgcctggtgtccaccacactgatt
gggacagaggtgatcacccccgatgagcagtttacacacatgctgatgcaatggggccag
ttccttgaccatgacctagactctacagtggtagccctgagccaggcccgcttctctgac
ggccagcattgcagctctgtgtgcagcaatgaccctccctgtttctcggtcatgatcccc
cccaatgatccccgggtgcggagtggcgcccgatgcatgttcttcgtgcgatcgagcccc
gtgtgtggcagcggcatgacgtccctgctcatgaactctgtgtaccctcgagagcagatc
aaccagctcacctcctacatcgatgcctccaatgtgtacggcagcacagaccacgaagcc
cgcagcatccgggacctggccagccaccgtggcctgctgcgtcagggcattgtgcagagg
tctggcaagcccctgcttccctttgccaccgggccacccactgagtgcatgcgcgatgag
aacgagagcccgataccatgctttctggccggcgaccaccgtgccaacgagcagcttggc
ctgaccagcatgcatacgctgtggttccgggagcacaaccgcattgcagcagagctgttg
aagctaaacccgcactgggatggggacactgtctaccatgagacccgcaagatagtcggg
gcagagatacagcacatcacctaccggcactggctgcccaagatcctgggggaggtgggc
atgaagatgctcggtgagtaccggggctacgaccccagtgtcaatgctggcatctttaat
gcctttgccactgcagccttcaggttcggtcacactctgatcaaccctctgctctaccgg
ctggatgagaactttgagcccatccctcagggccatgtgcccctccacaaagccttcttc
tcgcccttccggattgtcaacgaggggggcatcgacccacttctccgagggctgtttgga
gtggcagggaagatgcgcattccctctcaattgctgaacacagagctcacggagaggctg
ttctccatggcccacacagtggccctggacctggctgccatcaatatccagcgaggccgg
gaccatggcatcccaccctaccatgactacagagtctactgcaacttgtcggctgcttac
acctttgaggacctgaaaaatgagatcaagagccctgtgatccgggagaaactgcagagg
ctgtatggctcgactctcaacattgatctgttcccagccctcatggtagaagacctagta
cctggcagccgcttggggcccacactcatgtgcctgctcagcacacagttccgacgcctg
cgggatggagacaggttgtggtatgagaacccaggcgtgttctcccccgcccagctgact
cagctcaagcagacgtccctggcgaggatcctttgtgacaactcagacaacatcacccgt
gtgcagcaggatgtgttcagggtggcagagttcccccacggttatagcagctgtgaggac
atccccagggtggacctgcgagtgtggcaggactgttgtgaagattgtaggaccagggga
caattcaatgctttctcctaccatttccggggaagacggtctctagaatttagctatgag
gacgataagcccacaaagagagccaggtggcggaaagcactaagtgtaaagcatggcaaa
catcttagcaatgccacatcagccacccacgagcacttggaagggccagcaactaatgat
ctcaaggaatttgttctggaaatgcaaaagatcatcacagacctcagaaaacagataaac
agcttggagtctcggctcagcaccacagaatgtgtggatgacagcggtgaatctcacggc
ggcaacacaaagtggaaaaaagacccatgcacagtttgtgagtgcaaaaatggccagatc
acctgctttgtggaagcttgccagcctgcagcctgcccccagcctgtgaaagtggaaggc
gcttgctgtcccgtctgcttaaagaacactgcagaggaaaagccttag

DBGET integrated database retrieval system