KEGG   Mus musculus (mouse): 69700
Entry
69700             CDS       T01002                                 

Symbol
Col22a1, 2310067L16Rik, C80743
Name
(RefSeq) collagen, type XXII, alpha 1
  KO
K16630  collagen type XXII alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    69700 (Col22a1)
SSDB
Motif
Pfam: Collagen VWA VWA_2 Laminin_G_3
Other DBs
NCBI-GeneID: 69700
NCBI-ProteinID: NP_081450
MGI: 1916950
Ensembl: ENSMUSG00000079022
Vega: OTTMUSG00000033423
UniProt: E9Q7P1
Position
15; 15 D3
AA seq 1613 aa
MPVFTSRRAMAVPRGNPLACLLWILLLWGGDGGCQAQRAGCKSVQYDLVFLLDTSSSVGK
EDFEKVRQWVANLVDTFEVGPGHTRVGVVRYSDRPTTAFELGHFNSREEVKAAARRITYH
GGNTNTGDALRYITSRSFSAQAGGRPGNRAFKQVAILLTDGRSQDLVLDAAAAAHAAGIR
IFAVGVGAALKEELDEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGD
RFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMGSFPVVQRTEDVFPQGLPD
EYAFVTTFRFRKTSRKEDWYIWQVIDQYGIPQVSIRLDGENKAVEYNAVGAMKDAVRVVF
RGPRVDDLFDRDWHKMALSIQAQNVSLYIDCLLVQTLPIEERENIDIQGKTVIGKRLYDS
VPIDFDLQRIVIYCDSRHAELETCCDIPLGPCQVTVVTEPPPAPPQLPTPGSEQIGFLKT
INCSCPPGEKGERGFAGPLGLPGQKGDAGPIGLMGAPGPKGEKGDSGRGPFIHGEKGEKG
SLGPPGPPGRDGSKGMRGEPGELGEPGLPGEVGMRGPQGPPGLPGPAGPVGAPGLRGERG
ERGPPGEKGERGLDGFPGKPGETGEQGRPGPPGVAGLQGEKGDVGPAGPPGVPGSVVQRE
GLKGEQGAPGPRGHQGLPGPPGAPGLIGPEGRDGPPGPPGLRGKKGEMGPPGTPGALGPQ
GPPGPPGVPGPPGPGGPPGLPGELGFPGKPGPAGHAGTPGKDGLNGPPGLPGSKGEPGDS
GESGVPGMPGPRGEVGERGLAGHPGEKGEVGLPGAPGFPGVHGEKGDQGEKGELGLPGLK
GARGEKGEVGPAGPPGLPGSPSVFTPHPRMPGEQGPKGEKGDPGEPGALGPQGHPGELGP
RGPIGPPGAKGHDGAQGPPGAAGNPGAPGPAGPPGLSGPPGSLGSPGVRGAPGKDGERGE
KGTAGEEGSPGPAGPRGDPGAPGLPGPPGKGKDGEPGLRGPPGLPGPLGIKGDRGTPGIP
GSPGSRGDPGIGVAGPPGPSGRPGDKGPPGSRGLPGFPGPQGPAGQDGAPGNPGERGPPG
KPGPSSLLSPEDINLLVKDVCNDCPPGPPGLPGLPGFKGDKGLPGKQGREGTEGKKGDTG
PPGPPGPPGVAGPQGSQGERGAEGEVGQKGEQGHPGVPGFMGPPGNPGPPGADGNAGVAG
PPGPQGPQGKEGPPGPQGPSGIPGVPGEEGKQGRDGKPGPPGEPGKTGEPGLSGAEGARG
PPGFKGHTGDPGPPGLRGEPGIAGPSGRDGSPGKDGDTGPAGPQGPRGTRGPPGSSGSPG
SPGDPGRPGALGQKGNKGESGSPGLPGFQGPRGPPGEAGEVGAPGKEGAPGKPGEPGSKG
ERGDPGIKGDKGPPGGKGQPGDPGTPGHKGHTGLMGPQGQPGESGPPGPPGPPGQPGFPG
LRGESPSMDTLRRLIQEELGKQLEAKLAYLLAQMPPAHMKSSQGRPGPPGPPGKDGLPGR
TGPMGEPGRPGQGGLEGPSGPMGPKGERGAKGDPGTPGVGLRGEMGPPGIPGQPGEPGYA
KDGLPGSPGPQGETGLAGHPGPPGPPGPPGLCDPSQCAYFASLAARPSNVKGP
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgcctgtcttcacgagcaggagagccatggctgtccccagagggaatcctttggcctgt
cttctgtggattctactgctctggggaggggatggtggctgccaggcccaacgtgcaggt
tgcaaaagtgtgcagtatgatctggtcttcctcctggacacgtcttctagtgtgggcaag
gaggactttgagaaagtccgccagtgggtagccaacctggtagacacctttgaggtgggc
cctggccacacccgtgtgggggttgtgcgctacagtgaccggcccactacagcctttgaa
ctgggccacttcaactctcgcgaggaggtgaaggcagctgcgcggcgcatcacctaccat
ggcggtaacacgaacacgggtgacgccctgcgttatatcaccagccgcagcttctccgcc
caggccggcggcagacctgggaatcgtgccttcaagcaggtggccatcctgttgactgat
ggtcgtagccaagacctggtgctggatgctgcagcagctgcccatgcagccggcatccgc
atttttgctgttggtgtgggtgcagcattgaaggaggaactggatgagattgcctcagaa
cccaagtctgcgcatgtcttccatgtttccgacttcaatgccattgacaagatccgtggc
aagctgaggcgtcggctttgtgaaaatgtgctctgcccaagtgtccgggtagaaggagat
cggtttaaacataccaatggaggaaccaaggaaattacaggttttgacttgatggatttg
ttcagtgtgaaggaaatcttggggaagagagaaaacggagcccagagttcctatgtacgg
atgggttccttccctgtggtgcagagaactgaagatgtgtttccccaaggtcttcctgat
gagtatgcctttgtcacaactttccggttccggaaaacatcacggaaagaagattggtac
atctggcaagtcattgaccagtatggcatcccacaggtctctatccggctggatggtgag
aacaaggcagttgagtacaacgctgtgggtgccatgaaggatgctgtccgggtggtcttc
cgaggcccccgagttgatgacctctttgaccgtgactggcacaagatggctctaagcatc
caggcccagaatgtgtccctctacattgactgtttgctggttcagacgctgcctattgag
gagagggagaatatcgacatccagggcaagactgtgattggcaaacgtctctatgacagc
gttcccattgattttgacctgcagcggattgtgatttactgtgactcgagacatgcagaa
ctggagacttgctgtgacatcccgttgggtccgtgtcaggtgactgtggtgacagagccg
ccacctgcgcctccacagctgcccacccctgggagcgaacagatcgggttcttgaagacc
atcaactgctcatgccctcctggagaaaagggtgagaggggctttgctggccctctggga
ctccctggtcagaagggagatgcaggacccattggactaatgggtgctcctggacccaag
ggagaaaaaggagacagtggacgaggaccattcatccatggggaaaagggtgagaaggga
tccctgggcccacctgggccccctggaagagacggcagtaaaggcatgagaggagagcca
ggagagctaggagagccagggctgcctggagaagtgggcatgagggggccccagggacct
cctggactaccagggcctgctgggccagttggagctccaggtcttcgaggagaacgaggt
gaaagggggcctccaggagaaaagggggagcgaggcctggatggattccctgggaagcct
ggagagactggagagcagggaagacctgggcctcctggtgtggcaggactgcagggagag
aagggagatgtggggcctgcaggaccccctggtgtgccaggctctgtggtgcagagggaa
ggcctgaagggagagcagggagcccccggaccaagaggtcaccaaggcctacctgggcct
ccaggagcacctggtttgattggcccagaaggcagagatggacccccggggcctccaggt
ctccgagggaagaaaggagaaatgggtcccccaggaacccctggagcactggggccacag
ggcccgcctggaccacccggtgttccagggccccctggacctggaggacccccgggttta
cctggcgagctcggcttcccgggaaaacctgggcctgctgggcatgcggggacacctgga
aaggatgggctgaatggaccaccaggccttcctggctccaagggagaaccaggagactct
ggcgaaagtggcgtacctggaatgccaggacctcggggtgaagttggggagcggggcctt
gcaggtcatcctggtgagaagggagaagttggccttccgggtgctccaggcttcccagga
gtacatggagagaaaggagaccagggagaaaaaggtgaactgggacttccaggtctgaaa
ggtgcccgaggagaaaagggtgaggttggtccagcaggtccccctggcttacctggaagt
ccatcagtgttcacaccacacccaagaatgccaggagagcaagggcctaaaggagagaaa
ggtgatcctggcgagcctggagccctgggaccacagggccatcctggagaattgggtcct
cggggacccattggacctccgggtgccaaggggcatgatggtgcacaaggacctcctgga
gcagctggaaaccctggtgctccaggacctgcaggaccccctggtctcagtggaccccct
ggaagtttgggttctcctggtgtcaggggtgcccctgggaaagatggggagcgtggagag
aagggaacagcaggggaagaaggcagcccagggccagctggtccacggggagatcctggt
gctcctggtctcccagggccaccaggaaagggcaaggatggggagccgggactacgtgga
ccacctgggttacctggtcccttaggaatcaagggtgaccgaggaacacctgggattcct
ggctctcctggcagccgtggtgacccaggcattggggttgctggtccacctggtccctca
ggacgaccaggagataaaggacccccgggatctcgaggcttacctggattccccggcccc
cagggaccagctggccaggatggtgcaccaggaaacccaggagaaagagggcctcctgga
aaaccaggcccttcttcactgctgtctccagaggacataaatctcttagtaaaggatgtg
tgcaacgactgccctcctggtcccccaggcctcccaggtctgccaggtttcaaaggggac
aagggtcttccaggaaaacaagggagagaggggacagaaggcaaaaagggagataccggg
cctccaggcccccctgggcctccaggagtagctggaccacagggaagccaaggagaacgt
ggtgcagagggtgaggtgggacagaaaggtgaacagggtcaccctggagttccaggcttc
atgggcccaccggggaatcctgggccaccaggagcagatgggaatgcaggtgtggcgggg
ccaccaggacctcaagggcctcagggcaaagaaggccctcctggtccccaaggtccatct
ggcatcccaggagtcccaggagaagaaggcaagcagggcagagatggaaagccaggtccc
cctggagaaccgggcaagacaggagagccaggcctatcaggagcagagggagccagaggt
ccaccgggcttcaagggacacacaggtgatcctggcccacctggtctgaggggagaacct
ggcatagcaggaccctctggaagggatggatcaccaggaaaagatggtgacactggacct
gctggaccacagggtcccagaggaacaaggggaccaccgggcagcagtggatcacctgga
tctccaggagaccctggccgtccgggagccctaggccagaagggaaacaaaggagaaagt
ggcagcccaggacttccagggtttcagggtcctcgtggacctccaggagaagcaggagag
gtaggagctccaggaaaggagggtgctcctgggaagcctggagagccaggatccaaaggc
gagaggggagaccctgggatcaaaggtgacaaaggaccaccaggtgggaagggtcagcct
ggagaccctggaaccccaggccacaagggtcatactggcctaatgggtccccaaggacaa
ccaggagagagtggccctcctgggcccccagggccacctggccagccaggatttccagga
ctgaggggggagtctccatccatggacaccttacggcgcctcattcaggaagagcttggg
aagcagctagaagctaaacttgcctacctcctagcccagatgcctccagcacacatgaag
tcctctcaaggcagacccggacctcctggaccccctggaaaagatgggctgccaggtcgg
acaggccccatgggtgagccaggccgtcctggccaaggtggtctggaaggaccctctgga
ccaatgggccccaaaggtgaaagaggagccaaaggtgaccctggcacacctggagttggt
ctccgaggagagatgggtcctcctggaataccaggccaacctggggaacctggatacgct
aaagatggacttccaggaagccctggtcctcaaggagagacaggactagctggacatcct
ggccctcctggtcctcctggcccacctggcctgtgtgacccctcccagtgtgcgtacttt
gccagccttgctgcccggccaagtaatgtgaagggcccatag

DBGET integrated database retrieval system