KEGG   Mus musculus (mouse): 69714
Entry
69714             CDS       T01002                                 

Gene name
Tfpt, 2400004F01Rik, AI450389, Amida, FB1
Definition
(RefSeq) TCF3 (E2A) fusion partner
  KO
K11670  TCF3 fusion partner
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69714 (Tfpt)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    69714 (Tfpt)
SSDB
Other DBs
NCBI-GeneID: 69714
NCBI-ProteinID: NP_001277310
MGI: 1916964
Ensembl: ENSMUSG00000006335
Vega: OTTMUSG00000023400
UniProt: Q3U1J1
Position
7; 7 A1
AA seq 259 aa
MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGDSGLRER
DEEEEAARGRRRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFL
MRVLDSYGDDYRDSQFTIVLEDDGSQGTDVPTPGNAENEPPEKEGLSPSQRTTATLDPTS
PAPGEGPSGRKRRRAPRVGASLTPELAPVQVGAEGWGQGVIKVEEDFGFEADEALDSSWV
SREPDKLLPYPTLASPPFD
NT seq 780 nt   +upstreamnt  +downstreamnt
atggagttggaacagagagaggggaccatggcagccgtgggctttgaagagttctcagcg
ccaccaggctcagagctggctctgcctcccctgtttggtggccacatcctagaaagtgag
ctagagacagaagtggaatttgtgtccggtggtctgggtgattcaggactccgggagcga
gatgaagaggaagaggcagcccggggtcgaaggcgtcgccagcgggaactaaatcgtaga
aagtaccaggcactaggtcggcgctgccgggagatcgagcaggtgaatgagcgagtcttg
aacaggctccatcaggtgcaaaggataactcggagactccagcaggagcgcaggttcctc
atgagggtgctggactcctacggggatgactaccgagatagccagttcaccattgtgttg
gaggatgatggcagccaaggcacagatgtccctaccccaggcaatgctgagaatgaacct
ccagagaaagaggggctttccccatcccaaaggacaactgcaaccttagaccccaccagc
ccagcccctggcgaggggcccagtgggcggaagaggcggcgggcgccacgggtgggggct
tcattgactccagaactggccccagtgcaggtgggagccgagggctggggccaaggcgtg
attaaggttgaggaagactttggctttgaagcagatgaggccttggattcaagttgggtt
tcccgagagccagacaaattgctaccctaccctaccctggccagcccaccctttgactaa

DBGET integrated database retrieval system