KEGG   Mus musculus (mouse): 69717
Entry
69717             CDS       T01002                                 

Gene name
Gm10499, MumuTL
Definition
(RefSeq) predicted gene 10499
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    69717 (Gm10499)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    69717 (Gm10499)
   04145 Phagosome
    69717 (Gm10499)
  09143 Cell growth and death
   04218 Cellular senescence
    69717 (Gm10499)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    69717 (Gm10499)
   04612 Antigen processing and presentation
    69717 (Gm10499)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    69717 (Gm10499)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    69717 (Gm10499)
   05170 Human immunodeficiency virus 1 infection
    69717 (Gm10499)
   05168 Herpes simplex virus 1 infection
    69717 (Gm10499)
   05163 Human cytomegalovirus infection
    69717 (Gm10499)
   05167 Kaposi sarcoma-associated herpesvirus infection
    69717 (Gm10499)
   05169 Epstein-Barr virus infection
    69717 (Gm10499)
   05165 Human papillomavirus infection
    69717 (Gm10499)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    69717 (Gm10499)
   05330 Allograft rejection
    69717 (Gm10499)
   05332 Graft-versus-host disease
    69717 (Gm10499)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    69717 (Gm10499)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    69717 (Gm10499)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    69717 (Gm10499)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    69717 (Gm10499)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   69717 (Gm10499)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  69717 (Gm10499)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 69717
NCBI-ProteinID: NP_001357747
MGI: 3702919
Position
17; 17 B1
AA seq 397 aa
MAQRMLLLLLAAALTLIETRAGSHSMRYFETALSRPGLREPRFISVGYVDDTQFVRFDGD
AENPRYEPRAPWMEHEGREYWERETQIAKRNEQSFRGSLRTAQRYYNQSEGGLHTFQLLF
GCDVGSDGRLLRGYLQFAYDGRDYIALNEDLNTWTAADLAALITRRKWEQAGAAEHYKAY
LEGECVESLRRYLQLGKETLLRTDPPKAHVTHHPRSEGDVTLRCWALGFYPADITLTWQL
NGEELTQDIELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVEHEGLPEHLTLRWEPPPS
TDSNMVEKEGTMLRLEEAKVARALTCFWGPSKLSFLVLQALGDICILTAPCCPELQLLTS
TLRIRIWRDGSAVKRTDCSFRGPEFIPSTHMVAHNHL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcgcagcgaatgctgctcctgctgctggcggccgccctgaccctgatcgagacccgc
gcgggctcacactcgatgcggtatttcgagaccgccttgtcccgccctggcctccgggaa
ccccgattcatctctgtcggctacgtggacgacacgcagttcgtgcgcttcgacggcgac
gcggagaatccgaggtatgagccgcgggctccatggatggagcacgaggggcgggagtat
tgggagcgggagacacagatcgccaagcgcaatgagcagagtttccgagggagcctgagg
accgcgcagcgctactacaaccagagtgaaggcggccttcacacgttccagctgttgttc
ggctgtgacgtggggtcggacgggcgcctcctccgcggatacctacagttcgcttatgat
ggccgagattacatcgccctgaacgaagacttgaacacgtggacggcggcggacctggca
gcgctgatcacccgacgcaagtgggagcaggctggtgctgcagagcattacaaggcctac
ctagagggcgagtgcgtggagtcgctccgcagatacctgcagctcgggaaggagacgctg
ctgcgcacagatcccccaaaagcccatgtgacccatcaccccagatctgaaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgacccaggacatagagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaattacacatgc
catgtggaacatgaggggctgcctgagcacctcaccctgagatgggagcctcctccatcc
acggactccaacatggtggaaaaggaggggactatgctccggctggaggaagcaaaggtg
gccagggctctgacttgtttctgggggccttcaaagctatccttcctggtcctgcaggca
ctaggggacatctgcatcctgacagctccatgctgccctgagctgcagctcctcacttcc
acactgagaataagaatctggagagatggctcagcagttaagagaactgactgctctttc
agaggtcctgagttcattccaagcactcacatggtagctcacaaccatctgtaa

DBGET integrated database retrieval system