KEGG   Mus musculus (mouse): 69724
Entry
69724             CDS       T01002                                 

Gene name
Rnaseh2a, 2400006P09Rik, RNASEHI, RNHIA, RNHL
Definition
(RefSeq) ribonuclease H2, large subunit
  KO
K10743  ribonuclease H2 subunit A [EC:3.1.26.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    69724 (Rnaseh2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    69724 (Rnaseh2a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     69724 (Rnaseh2a)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    69724 (Rnaseh2a)
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-GeneID: 69724
NCBI-ProteinID: NP_081463
MGI: 1916974
Ensembl: ENSMUSG00000052926
Vega: OTTMUSG00000020631
UniProt: Q9CWY8
Structure
PDB: 
3P5J 3KIO

Position
8; 8 C3
AA seq 301 aa
MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADL
EALKVADSKTLTENERERLFAKMEEDGDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHD
TAAGLIQYALDQNVNVTQVFVDTVGMPETYQARLQQHFPGIEVTVKAKADSLFPVVSAAS
IFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLRKHVDPVFGFPQFVRFSWS
TAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTCRPQAPHRYFQERGLEAASS
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atggatctcagcgagctggagagggacaatacgggtcgttgtcgtctgagttctcctgta
cctgctgtgtgtctcaaggagccgtgcgttctgggcgtggatgaagcgggccgaggccct
gtgcttggtcccatggtctacgccatctgttactgccccctgtctcgcttggcagatctg
gaggccctgaaagtggcagactctaagaccttgacagagaacgagcgggagaggctcttt
gcgaaaatggaggaggatggagactttgtgggttgggctttggacgtcctgtctccaaac
ctgatctctaccagcatgcttgggcgagtcaagtacaacctcaactccctgtcacacgat
acagctgcggggctgatacagtacgcactggaccagaatgtgaatgtcactcaggtattt
gtggacactgtaggaatgccagagacataccaggctcgattacaacagcactttcccggg
atagaggtgacagtcaaggccaaagctgactccctgttccctgtggtcagtgctgccagc
atctttgccaaggtggcccgagacaaggctgtgaagaactggcagtttgtggaaaattta
caggatctggactccgattatggctcaggctatcccaatgatcccaagaccaaagcctgg
ctgaggaaacatgtggaccctgtgtttggctttccccagtttgtacggttcagttggagc
acagcccaggccatcctggagaaggaggcagaagatgtcatttgggaggactcagaagct
gaggaggatcctgaaagaccgggaaaaatcacctcctacttcagccagggcccgcagacc
tgccgccctcaggccccccacagatacttccaggagcgaggcctggaggcagccagcagc
ctctag

DBGET integrated database retrieval system