KEGG   Mus musculus (house mouse): 69737
Entry
69737             CDS       T01002                                 
Symbol
Ttl, 2410003M22Rik, 2700049H19Rik
Name
(RefSeq) tubulin tyrosine ligase
  KO
K06047  tubulin---tyrosine ligase [EC:6.3.2.25]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    69737 (Ttl)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.25  tubulin---tyrosine ligase
     69737 (Ttl)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Other tubulin modification proteins
      69737 (Ttl)
SSDB
Motif
Pfam: TTL ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Other DBs
NCBI-GeneID: 69737
NCBI-ProteinID: NP_081468
MGI: 1916987
Ensembl: ENSMUSG00000027394
UniProt: P38585
Position
2:128907867..128938203
AA seq 377 aa
MYTFVVRDENSSVYAEVSRLLLATGYWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLAQ
LVNYYRGADKLCRKASLVKLVKTSPELSESCSWFPESYVIYPTNLKTPVAPAQNGIQLPV
SNSRTDEREFFLASYNRKKEDGEGNVWIAKSSAGAKGEGILISSEASELLDFIDSQGQVH
VIQKYLERPLLLEPGHRKFDIRSWVLVDHQYNIYLYREGVLRTASEPYHVDNFQDKTCHL
TNHCIQKEYSKNYGKYEEGNEMFFEEFNQYLTSALNITLESSILLQIKHIIRSCLMSVEP
AISTKHLPYQSFQLLGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAISSVFP
PPDTEQVPQQPAAFVKL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtacaccttcgtggtgcgcgacgagaatagcagcgtctacgccgaggtctcccggctg
ctgctggccaccggctactggaagaggctacggcgagacaaccccaggttcaacctgatg
ctgggggagaggaaccgactgcccttcgggagactaggtcacgagcctgggctggcacag
ctggtgaattactaccggggggcggacaaactgtgccgcaaagcttccttagtaaagcta
gtcaagaccagtccggaactgtctgagtcctgctcatggttccccgagtcgtatgtgatt
tatccaactaacctcaagacgccagtcgctccggcgcagaatggcatccaacttccggtc
agtaactccaggacagatgagagagaattcttcttggcttcttataacagaaagaaagag
gacggggagggcaacgtttggattgcaaagtcatcagctggtgccaaaggtgagggcatc
ctcatctcctcagaggcatcggagcttctggatttcatcgacagccagggccaagtgcac
gtgatccagaaatacctcgagcgccctctgctcctcgagcccggccaccgcaagtttgac
attcgaagctgggtcctggttgaccatcagtataacatctacctctatagagagggtgtg
cttcgaactgcttcagaaccatatcatgttgataatttccaagataagacctgccatctg
accaatcactgcattcagaaagagtactcaaagaactatgggaaatacgaagaagggaat
gaaatgttcttcgaagagttcaatcagtacctaaccagcgctctgaacatcaccttagaa
agtagcattttgctgcaaatcaaacacataataaggagctgcctcatgagtgtggagccc
gccatcagcaccaaacacctcccttaccagagcttccagctcctcggctttgacttcatg
gtggacgaggagctgaaggtctggctcattgaagtcaacggcgccccagcgtgtgcccag
aaactctatgcagaactgtgccagggcatcgtggacatagccatatccagtgtcttccca
cccccggacacggagcaggtgccgcagcagccggctgcgttcgtcaagctgtga

DBGET integrated database retrieval system