KEGG   Mus musculus (mouse): 69745Help
Entry
69745             CDS       T01002                                 

Gene name
Pold4, 2410012M21Rik, AI463381, AW060307, Polds, p12
Definition
(RefSeq) polymerase (DNA-directed), delta 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
mmu05166  HTLV-I infection
Module
mmu_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    69745 (Pold4)
   00240 Pyrimidine metabolism
    69745 (Pold4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    69745 (Pold4)
   03410 Base excision repair
    69745 (Pold4)
   03420 Nucleotide excision repair
    69745 (Pold4)
   03430 Mismatch repair
    69745 (Pold4)
   03440 Homologous recombination
    69745 (Pold4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    69745 (Pold4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    69745 (Pold4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      69745 (Pold4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     69745 (Pold4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 69745
NCBI-ProteinID: NP_081472
MGI: 1916995
Ensembl: ENSMUSG00000024854
UniProt: Q9CWP8 Q547B4
Position
19; 19 A
AA seq 107 aa AA seqDB search
MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP
CTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggaggggccc
cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc
caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct
tgtacaggtatcacaaggctgcagcgctggagtcgggcagagcagatgggcttgaagccc
cccctagaggtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc
ctgtggcatctctacccactctga

DBGET integrated database retrieval system