KEGG   Mus musculus (mouse): 69745
Entry
69745             CDS       T01002                                 

Gene name
Pold4, 2410012M21Rik, AI463381, AW060307, Polds, p1, p12
Definition
(RefSeq) polymerase (DNA-directed), delta 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    69745 (Pold4)
   03410 Base excision repair
    69745 (Pold4)
   03420 Nucleotide excision repair
    69745 (Pold4)
   03430 Mismatch repair
    69745 (Pold4)
   03440 Homologous recombination
    69745 (Pold4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    69745 (Pold4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69745 (Pold4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    69745 (Pold4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      69745 (Pold4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     69745 (Pold4)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 69745
NCBI-ProteinID: NP_081472
MGI: 1916995
Ensembl: ENSMUSG00000024854
UniProt: Q9CWP8 Q547B4
Position
19; 19 A
AA seq 107 aa
MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP
CTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggaggggccc
cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc
caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct
tgtacaggtatcacaaggctgcagcgctggagtcgggcagagcagatgggcttgaagccc
cccctagaggtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc
ctgtggcatctctacccactctga

DBGET integrated database retrieval system