KEGG   Mus musculus (mouse): 69748Help
Entry
69748             CDS       T01002                                 

Gene name
Aldh16a1, 2410004H02Rik, AI452234
Definition
(RefSeq) aldehyde dehydrogenase 16 family, member A1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-GeneID: 69748
NCBI-ProteinID: NP_666066
MGI: 1916998
Ensembl: ENSMUSG00000007833
Vega: OTTMUSG00000023570
UniProt: Q571I9 A0A1B0GSU0
Position
7; 7 B3
AA seq 802 aa AA seqDB search
MAATRVQPSTREIFTTLEYGPVPESHACALAWLDTHNRLLGHHVNGMWLKPEHRNPAPCQ
DPITGENLASCLQAEAEDIAAAVEAAKIAFKAWSQLPGAARGQHLTRLAKVVQKHQRLLW
TLESLVTGRAVREVRDGDVPLAQQLLQYHAVQAHAQGDALADWQPVGVIGLILPTPFSFL
DMMWRVCPALAMGCTVVALVPPAFPTPLLLAQLAGELGSFPGILNVVCGPASLGPVLASQ
PGVQKVAFCGAVEEGRVLRRTLAGRGAELGLALGTESLLLLMDSADVDSAVEGVVDAVWS
DRSLGGLRLLIQESVWDEAMRRLQARMAQIRSGRGLDGAVDMGARGAAARDLAQSFVDEA
QSQGGQVFQAGDVPSSSPFFSPALVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDG
LYEYLQPLGTPSQESFLCENINYDTFGLAASSILPSGPETGPSPAPPYGLFVGGRFQSPG
TQSSRPIQDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQSPRARAGLLWALAAALE
RRKPVLTSQLERHGAAPTVAKIEVELSVRRLQTWGTRVQDQGQTLQVTGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAHGNAVVLVPSGACPLLALEVCQDIAPLFPAGLVS
VVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWASAGNLKSVWVNRGFPRAWDVEVQ
GAGQELSLHAARTKALWLPMGD
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcggctacgcgtgtacagcccagtacccgggagattttcacgacgctggagtacgga
ccggtgccggagagccacgcatgcgcactggcctggctggacacccacaaccgcctcttg
ggccaccatgtcaatgggatgtggctgaagccagaacacaggaatccagcgccttgccag
gatcccatcacaggagaaaacctggccagctgcttgcaagcagaggctgaggacatcgct
gcagctgtggaggctgcaaagatagcattcaaggcctggagccaactccctggagctgct
cggggacaacacctaacccggctggccaaggtcgttcagaagcaccagcgactgctgtgg
accctggaatccctggtcactggacgggctgttcgagaggttcgagatggagatgtgcca
ctggcccagcaactgctccagtaccatgcagtccaggcacatgcccagggtgacgcactg
gcagactggcagcccgtgggagtcattggcctcatcctgccgactcctttctctttcttg
gacatgatgtggagggtctgccctgccttggctatgggctgcaccgtggtggccctcgtg
cccccagccttcccgacacctctcctcctggctcagctggcaggagagcttggctctttc
ccagggatcctcaatgtggtatgtggccctgcctcgctggggcctgtcctggcctcccaa
cctggagtccagaaggtggctttctgcggagccgtggaggaaggacgtgttctgcgacgg
actctagcaggcaggggagctgagctgggcctggccctgggcacagagtcactgttgcta
ttgatggactccgcagatgtggactcagctgtggagggtgtcgtggatgccgtctggtca
gaccgcagcctgggggggctcaggctcctcatccaggaatctgtatgggatgaagctatg
aggcgactccaggccagaatggcacagatacggagtgggagaggactggatggggctgtg
gacatgggggctcgaggagctgctgcccgagacctggcccagagctttgtggatgaggcc
caaagccaagggggacaggtattccaagctggtgatgtgccctccagtagcccattcttc
tctccagccttggtttctggtctgcctccagcagccccatgtgcccaggccgaggtaccg
tggcctgtggttatggcttctcctttccgcacagtcaaggaggcactagccctggccaat
ggaacaccccggggaggcagcgccagcgtgtggagtgaaaggctagggcaagccctggag
ctgggctatgggctccaggtgggcacagtgtggatcaatgctcatggcctccgagaccct
gcggtgccgacagggggctgcaaggagagtgggtcttcctggcacggaggcccagatggc
ctgtatgagtacctgcagcccttggggacaccttcccaggagtccttcctttgtgagaat
atcaactacgacacatttggccttgctgcgtcctccattctgccgtcagggccagaaaca
gggcctagcccagcccctccctatgggctgtttgtcggaggccgtttccagtctcctggg
acccagagctccaggcccatccaagattcttcaggcaaagtctccagctatgtagctgag
ggtggagccaaggatatccgaggtgctgtagaggctgctcatcaggctgcccctggctgg
ggagcccagtccccaagagcccgagcaggcctgctgtgggccctggcggctgctctggag
cgcaggaagccagtgctgacctcacaactagaaaggcacggagcagcgcctacagttgcc
aagattgaagtagaactgagtgtgaggcgactccagacatggggcacccgggttcaggac
caaggccagacactacaggtaacaggattgagaggccctgtgctccggcttcgagaacca
ttgggagtgctggccgtggtgtgcccggatgagtggcccctgctggcttttgtgtcacta
ctggcccctgcactggcccatggcaatgccgtggtcttagtacccagtggggcatgtcct
ctgctggccttggaggtctgccaggatatagctcctctgtttcctgctggcctggtgagt
gtagtgacaggggatcgcgaccacctgacccgctgtctggccttacatcaggatgtccaa
gccctgtggtacttcggctcggcccagggctcccagtttgtggaatgggcctctgcagga
aacctcaagtctgtgtgggtaaacaggggcttcccaagggcctgggatgtggaggtccag
ggggcaggacaggagctgagtcttcacgcagcacgaacaaaggccctgtggctgccaatg
ggggactga

DBGET integrated database retrieval system