KEGG   Mus musculus (house mouse): 69772
Entry
69772             CDS       T01002                                 
Symbol
Bdh2, 1810026B04Rik, Dhrs6
Name
(RefSeq) 3-hydroxybutyrate dehydrogenase, type 2
  KO
K25939  4-oxoproline reductase [EC:1.1.1.104]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    69772 (Bdh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.104  4-oxoproline reductase
     69772 (Bdh2)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR ADH_zinc_N AlaDh_PNT_C 3HCDH_N UDPG_MGDP_dh_N DUF2325 Sacchrp_dh_NADP DUF1776
Other DBs
NCBI-GeneID: 69772
NCBI-ProteinID: NP_081484
MGI: 1917022
Ensembl: ENSMUSG00000028167
UniProt: Q8JZV9
Position
3:134986982..135010187
AA seq 245 aa
MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYRGIQTRVLDVT
KKRQIDQFASEIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKM
LAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggccgactggacggcaaagttattgtcctgacagctgccgctcaagggattggacgg
gcatccgcattagcttttgcaagagaaggagccaaagtcatagccacagatatcaacgag
tccaaactccaggagctggaaagttaccgaggtattcaaactcgagtccttgatgtcaca
aagaagagacagattgatcagtttgcctcagaaatcgagagaattgatgttctctttaat
gttgctggttttgtccaccacggaaccatcctggattgcgaggaaaaagactgggacttc
tcaatgaatctcaacgtccgcagcatgttcctgatgatcaaagcattccttcccaaaatg
cttgctcagaagtcaggcaacattatcaacatgtcgtctgtggcctccagcatcaaaggg
gtggagaacagatgtgtgtacagtgctaccaaggcggctgtgatcggtctcaccaagtcc
gtggctgcagacttcatccaacagggcatcagatgcaactgtgtgtgtccaggaacggtt
gacaccccatctctgcaagaaagaatacaagccagagacaatcccaaagaggcactgaaa
actttcctaaacagacaaaagacgggaaggtttgcgtcggccgaagaggtcgctctgctc
tgcgtatacctggcctcggacgagtcagcctatgtaactggcaaccctgtcatcattgat
gggggctggagcctgtga

DBGET integrated database retrieval system