KEGG   Mus musculus (house mouse): 69774
Entry
69774             CDS       T01002                                 
Symbol
Ms4a6b, 1810027D10Rik
Name
(RefSeq) membrane-spanning 4-domains, subfamily A, member 6B
  KO
K22191  membrane-spanning 4-domains subfamily A member 5/6/7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    69774 (Ms4a6b)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   69774 (Ms4a6b)
SSDB
Motif
Pfam: CD20 DUF6114 DUF6057
Other DBs
NCBI-GeneID: 69774
NCBI-ProteinID: NP_081485
MGI: 1917024
Ensembl: ENSMUSG00000024677
UniProt: Q99N09
Position
19:11495923..11507767
AA seq 244 aa
MIPQVVTSETVAMISPNGMSLPQTDKPQPFHQWQDSLKKHLKAEIKVMAAIQIMCAVMVL
SLGIILASVPSNLHFTSVFSVLLKSGYPFIGALFFIVSGILSIVTETKSTKILVDSSLTL
NILSVSFAFMGIIIISVSLAGLHPASEQCLQSKELRPTEYHYYQFLDRNECFAAKSVLAG
VFSLMLISTMLELGLAVLTAMLWWKQSHSNIPGNVMFLPHSSNNDSNMESKVLCNPSYEE
QLVC
NT seq 735 nt   +upstreamnt  +downstreamnt
atgattccacaagtagtgaccagtgagactgtggcaatgatttcgccaaatggaatgagt
cttccccaaacagacaaaccccagcctttccaccagtggcaagacagcctgaagaaacat
ctaaaggctgagatcaaagtgatggcggcaatccagatcatgtgtgctgtgatggtgttg
agtctgggaatcattttggcatctgttccctccaatctacactttacctcagtgttttca
gtcctgttaaaatctggctacccatttataggagctttgttttttatagtctctggaatt
ctgtccatcgtcacggagacaaagtcaacaaaaattttggtagacagcagcctgactctg
aatatcctgagtgtttcatttgctttcatgggcatcattatcatctctgtcagcctggct
ggtttgcatcctgcctcagagcagtgcttgcagagcaaggagcttagaccaactgaatat
cattactaccaattcttggacaggaacgagtgctttgccgccaagtctgttctggctgga
gtcttttcactgatgctgatcagtactatgttggaacttggcctggctgtcctcactgcc
atgctgtggtggaaacagagtcactctaacatccctgggaatgttatgttcctgccacat
agctcaaataatgactccaacatggaatcaaaggtactttgtaacccctcatatgaggaa
caattggtttgttaa

DBGET integrated database retrieval system