KEGG   Mus musculus (mouse): 69780Help
Entry
69780             CDS       T01002                                 

Gene name
Smap2, 1810031K02Rik, AA408614, Smap1l
Definition
(RefSeq) small ArfGAP 2
  KO
K12486  stromal membrane-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    69780 (Smap2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69780 (Smap2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    69780 (Smap2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    69780 (Smap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap
Motif
Other DBs
NCBI-GeneID: 69780
NCBI-ProteinID: NP_598477
MGI: 1917030
Ensembl: ENSMUSG00000032870
Vega: OTTMUSG00000008854
UniProt: Q7TN29
Position
4; 4 D2.2
AA seq 428 aa AA seqDB search
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEK
KKYMDRSLDINVLRKEKDDKWKRGNEPAPEKKMEPVVFEKVKMPQKKEDAQLPRKSSPKS
AAPVMDLLGLDAPVACSIANSKTSNALEKDLDLLASVPSPSSVSRKAVGSMPTAGSAGSV
PENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFP
GVTPPNSIMGGMVPPPVGMVAQPGASGMLTPMAMPAGYMGGMQASMMGVPNGMMTTQQAG
YMASMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMGGGNGQAANQ
TLSPQMWK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaagtcggtgaaggacgtggatcggtaccaggcggtcctggccaacctgctg
ctggaggaagataacaagttctgtgctgactgccagtccaaagggccgagatgggcctcc
tggaacatcggggtgttcatctgcattcggtgtgctgggatccacaggaatttgggggtg
catatatccagggtaaaatcagtgaacctcgaccagtggactcaagaacagattcagtgc
atgcaagagatggggaatggaaaagcaaaccgactctatgaagcctaccttcccgagacc
tttcggcgacctcagatagacccagctgttgaaggatttattcgagataaatatgagaag
aagaaatatatggaccgaagtctggacatcaatgtccttaggaaagagaaggatgataag
tggaaacgagggaatgaacccgctccggagaaaaagatggaacctgttgtttttgagaaa
gtaaaaatgccacagaaaaaagaagacgcacagctacctcggaaaagctctccgaaatct
gcagcccctgtcatggacttgttgggccttgatgctcctgtggcctgctcaattgcaaac
agtaagaccagcaatgccctagaaaaggatctagatcttttggcctctgttccgtcccct
tcttcagtttccagaaaggctgtaggttccatgccaactgcagggagtgctggttctgtc
cctgaaaacctgaacctatttccagagccagggagcaaatcagaagaaacaggcaagaaa
cagctctccaaggactccatcctatcactgtatggatcccagacgcctcaaatgcctgcc
caagcaatgttcatggctcctgctcagatggcataccccacagcttaccccagtttcccc
ggggttacaccacctaacagcatcatggggggcatggtgcctccgccagtaggcatggta
gctcaaccgggagcctctggaatgctaacccctatggccatgcctgcaggctatatgggg
ggcatgcaggcgtccatgatgggtgtgccgaacgggatgatgaccactcagcaggccggc
tacatggcaagcatggcagctatgccgcagactgtgtatggagttcagccagctcagcaa
ctgcaatggaaccttactcagatgacccagcaaatggctgggatgaacttctacggagcc
aacggcatgatgaactatggacagtcaatgggcggtggaaatggccaggcagccaatcag
actctcagtcctcagatgtggaaataa

DBGET integrated database retrieval system