KEGG   Mus musculus (mouse): 69790
Entry
69790             CDS       T01002                                 

Symbol
Med30, 1810038N03Rik, 2510044J04Rik, TRAP25, Thr, Thrap6, Tra
Name
(RefSeq) mediator complex subunit 30
  KO
K15143  mediator of RNA polymerase II transcription subunit 30
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    69790 (Med30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69790 (Med30)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     69790 (Med30)
SSDB
Motif
Pfam: Med30 APG17 UPF0449 NYD-SP28_assoc
Other DBs
NCBI-GeneID: 69790
NCBI-ProteinID: NP_081488
MGI: 1917040
Ensembl: ENSMUSG00000038622
UniProt: Q9CQI9
Position
15; 15 C
AA seq 178 aa
MSTPPLAPTGMASGPFGGPQAQQAAREVNTATLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVDE
DGSKNDDRAGPPRFASEERREIVEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtccacccctccgctggcgcccacgggcatggcgtccgggcccttcggcggcccgcag
gctcagcaggccgcgcgcgaggtcaacacggccacgctgtgccgcatcgggcaggagacc
gtgcaggacatcgtgtaccgcaccatggagatcttccagctgctcaggaacatgcagctg
ccaaatggtgtcacttaccatactggaacttaccaagaccggctaacaaagctgcaggac
caccttcggcaactttctattctcttcaggaagctgcgactggtctatgacaaatgtaat
gagaactgtggtgggatggaccccattcctgttgagcaactgattccatatgtggatgaa
gatggctcaaagaacgacgaccgggctggtccacctcgttttgctagcgaagagagacga
gaaattgtagaagtaaataagaaactcaaacagaagaatcaacagctgaagcagattatg
gatcaattacggaatctcatctgggacataaatgccatgctggcaatgaggaactaa

DBGET integrated database retrieval system