KEGG   Mus musculus (mouse): 69810
Entry
69810             CDS       T01002                                 

Gene name
Clec4b1, 1810046I24Rik, Aplra2, Clec4b, DC, DCAR, DCARb, DCARbeta, Dcar2, mDca
Definition
(RefSeq) C-type lectin domain family 4, member b1
  KO
K17514  C-type lectin domain family 6 member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    69810 (Clec4b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    69810 (Clec4b1)
   04091 Lectins [BR:mmu04091]
    69810 (Clec4b1)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   69810 (Clec4b1)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    69810 (Clec4b1)
SSDB
Motif
Pfam: Lectin_C Comm CHORD
Other DBs
NCBI-GeneID: 69810
NCBI-ProteinID: NP_001177239
MGI: 1917060
Ensembl: ENSMUSG00000030147
Vega: OTTMUSG00000034578
UniProt: Q7TS58
Position
6; 6 F2
AA seq 209 aa
MVQERQLQGKAVSWSLRLWSAAVISILLLSTCFIASCVVTYQFSMDKPNRRLSELDRYHS
LTCFSEGNMVSDKVWSCCPKDWKLFGSHCYLVPTVFSSASWNKSEENCSRMGAHLVVIHS
QEEQDFITGILDIHAAYFIGLWDTGHRQWQWVDQTPYEESVTFWHNGEPSSDNEKCVTVY
YRRNIGWGWNDISCNLKQKSVCQMKKINL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggttcaggaaagacagctacaagggaaggcagtctcctggtccctgagactctggtca
gctgctgtgatttctatcttactcctcagcacctgtttcattgcgagctgtgtggtcact
taccagtttagtatggacaagccaaatagaagactatctgaacttgacaggtaccattca
ttgacctgcttcagtgaagggaatatggtgtcagacaaagtctggagctgttgcccaaag
gattggaagctatttggttcccactgctacttggttcccacagttttttcatcagcatct
tggaacaagagtgaggagaactgctcccgcatgggtgctcatctagtggtgatccatagc
caggaggagcaggatttcatcactgggatcttggacattcatgctgcttattttataggg
ttgtgggatacaggccatcggcaatggcaatgggttgatcagacaccatatgaagaaagt
gtcacattctggcacaatggtgagcccagcagtgacaatgaaaaatgtgttacagtatat
taccgtcggaatattggatggggctggaatgatatctcttgcaatcttaaacagaagtca
gtttgtcagatgaagaaaataaacttatga

DBGET integrated database retrieval system