KEGG   Mus musculus (mouse): 69824
Entry
69824             CDS       T01002                                 

Gene name
Glod5, 2010001H14Rik, AV061890
Definition
(RefSeq) glyoxalase domain containing 5
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Glyoxalase Glyoxalase_2 Glyoxalase_4 Glyoxalase_3
Other DBs
NCBI-GeneID: 69824
NCBI-ProteinID: NP_081503
MGI: 1917074
Ensembl: ENSMUSG00000031163
Vega: OTTMUSG00000018009
UniProt: Q9D8I3
Position
X; X A1.1
AA seq 148 aa
MCDPTSESQLWRSSSQIPSPCLICRLDHIVMTVKNIEDTTMFYSKILGMEVTTFKGNRKA
LCFGDQKFNLHEVGKEFDPKAAHPVPGSLDVCLITEAPLEEVIERLKAFDVPIEEGPVFR
TGAKGPILSIYFRDPDRNLLEVSSYVTS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtgtgatccaacatctgaaagtcagttatggagaagcagcagccagatcccttccccg
tgtcttatctgtagacttgaccacattgtgatgactgtaaagaacattgaagacaccacc
atgttttattccaagatcctgggcatggaggtcactactttcaagggaaaccggaaagca
ttgtgtttcggagaccaaaaatttaacttacacgaggtgggaaaggaatttgaccccaaa
gcagctcaccctgttccaggctccctggatgtttgtttgatcacagaagcacccctggag
gaggtgatcgagcgcctaaaggcttttgatgtccccattgaagagggcccagtattcaga
acaggagcaaaggggcctattctatccatctacttccgagatccggacagaaatctcctt
gaggtgtccagctatgtcacttcatga

DBGET integrated database retrieval system