KEGG   Mus musculus (mouse): 69833
Entry
69833             CDS       T01002                                 

Gene name
Polr2f, 1810060D16Rik, RPB6
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide F
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    69833 (Polr2f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    69833 (Polr2f)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    69833 (Polr2f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69833 (Polr2f)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69833 (Polr2f)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     69833 (Polr2f)
  RNA polymerase III system
   RNA polymerase III
     69833 (Polr2f)
  RNA polymerase I system
   RNA polymerase I
     69833 (Polr2f)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      69833 (Polr2f)
SSDB
Motif
Pfam: RNA_pol_Rpb6 BDHCT_assoc
Other DBs
NCBI-GeneID: 69833
NCBI-ProteinID: NP_081507
MGI: 1349393
Ensembl: ENSMUSG00000033020
UniProt: P61219
Position
15 E1; 15 37.7 cM
AA seq 127 aa
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtcagacaacgaggacaatttcgacggcgacgactttgatgacgttgaggaggacgaa
ggacttgacgacttggaaaatgctgaggaggagggccaggaaaatgtcgagattctccca
tctggtgagcgaccacaggccaaccagaagcggatcaccactccttacatgaccaagtat
gagcgggcccgggtgctgggcacccgggctcttcagatcgcgatgtgtgccccggtgatg
gtggagctggagggggagacagaccctttgctcatcgccatgaaggaactcaaggcgcgg
aagatccccatcatcattcgccggtacctgccagacggcagctatgaggactggggcgtg
gacgagcttatcatcagcgactga

DBGET integrated database retrieval system