KEGG   Mus musculus (house mouse): 69834
Entry
69834             CDS       T01002                                 
Symbol
Rab43, 1810048P08Rik, 2500004H21Rik, AW490415
Name
(RefSeq) RAB43, member RAS oncogene family
  KO
K07930  Ras-related protein Rab-43
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    69834 (Rab43)
   04031 GTP-binding proteins [BR:mmu04031]
    69834 (Rab43)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   69834 (Rab43)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab19/30/43 [OT]
    69834 (Rab43)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU SRPRB TniB
Other DBs
NCBI-GeneID: 69834
NCBI-ProteinID: NP_001034483
MGI: 1917084
Ensembl: ENSMUSG00000030055
UniProt: Q8CG50 Q0PD10
Position
6:complement(87765835..87789146)
AA seq 210 aa
MAGPGPGDQDEHYDFLFKLVLVGDASVGKTCVVQRFKTGAFSARQGSTIGVDFTMKTLEI
QGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDISKRSTFLSVPHWIEDVRKYAGS
NIVQLLIGNKSDLADFREVPLAEAQSLAEHYDILCAIETSAKDSSNVEEAFTRVATELIM
RHGGPMFSEKNTDHIQLDSKDIAESWGCGC
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgggccctggcccgggagatcaggacgaacactacgatttcctgttcaagctggtg
ttagtgggcgacgcgagcgtgggcaagacgtgcgtggtgcagcgcttcaagaccggcgcc
ttctcggcgcgtcagggcagcaccatcggtgtcgacttcaccatgaagacgctggagatc
cagggcaagcgggtcaagttacagatttgggacacagctggccaggagcggttccggacc
atcacccagagctactaccgaagtgccaatggggctatccttgcgtacgacatcagcaag
aggagcaccttcttgtcagtgcctcactggatcgaggatgtgaggaagtacgcgggttcc
aacatcgtgcagctgctgattgggaacaagtcagaccttgccgatttccgggaggtccca
ttggcggaggcacagagcctggctgagcactatgacatcctctgtgccatcgagacctcc
gcaaaggactccagcaatgtggaggaggccttcaccagagtggccacggagctcatcatg
aggcacggaggtcccatgttcagtgagaagaacacagaccacatccagctggacagcaag
gacattgcggagagctggggctgtgggtgctga

DBGET integrated database retrieval system