KEGG   Mus musculus (mouse): 69860Help
Entry
69860             CDS       T01002                                 

Gene name
Eif1ad, 2010003J03Rik, AI131644
Definition
(RefSeq) eukaryotic translation initiation factor 1A domain containing
  KO
K15025  probable RNA-binding protein EIF1AD
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    69860 (Eif1ad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-1a
Motif
Other DBs
NCBI-GeneID: 69860
NCBI-ProteinID: NP_081512
MGI: 1917110
Ensembl: ENSMUSG00000024841
UniProt: Q3THJ3
Position
19; 19 A
AA seq 170 aa AA seqDB search
MSQASKRKHVVQEVLGEHMVPSDHQQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKN
IWIKRGDFLIVDPIEEGEKVKAEISFVLCKNHVRSLQKEGHWPEAFSEVAEKQNNMNRES
QPELPAEPQLSGEGSSSEDDSDLFVNTNHRQYHESEEESEEDEEEEEEAA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggccagcaagaggaagcatgtggtgcaggaggtgctgggggagcacatggtg
ccttctgaccaccagcaaatagtgaaagtcctcaggactcctgggaacaatctgcatgag
gtggaaacagcacaggggcagcgcttcctggtgagcatgccctccaaataccgcaagaac
atctggatcaagagaggggatttcctcattgttgaccctattgaagaaggagaaaaagtg
aaggctgagatctcttttgtgctctgcaagaaccatgtccgctctctacagaaggagggt
cactggcctgaggccttctctgaggtagctgagaaacagaacaatatgaacagagagagt
caaccagaactccctgctgagccacagctgtcaggagaagggtcaagttctgaagatgat
tctgacctctttgtcaacaccaatcacagacagtatcatgagagtgaggaggagagtgaa
gaagacgaggaggaggaggaggaggcagcctga

DBGET integrated database retrieval system