KEGG   Mus musculus (mouse): 69861
Entry
69861             CDS       T01002                                 

Symbol
2010003K11Rik, Nrnp1
Name
(RefSeq) RIKEN cDNA 2010003K11 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4633
Other DBs
NCBI-GeneID: 69861
NCBI-ProteinID: NP_081513
MGI: 1917111
Ensembl: ENSMUSG00000042041
UniProt: Q8VC23 A0A678XUL2
Position
19:complement(4546816..4548611)
AA seq 124 aa
MGTSLRSQSFREPRPSYGRLHESQGRSLDGRLHRALSLRLGREKSRSQVPDGTEGLEVSV
QERLPGTLGDKEQLIQGQRGGGSRRWLRQYQQHVKRRWRSFVASFPSVTLSQPASPETLL
DTNN
NT seq 375 nt   +upstreamnt  +downstreamnt
atggggaccagcctgcgtagccagtcctttagagaaccccggccctcctatgggaggctc
catgagtcccaggggaggtctctggatggccgactccacagagcactgagcctcagactg
ggccgtgagaagtccaggtcgcaggtccccgatggcacggaagggctggaggtctctgtc
caggagcggctgccagggaccctgggagacaaagaacagctgatccaaggccagagagga
ggaggcagccggcggtggctgagacagtaccagcagcatgtgaaaagaaggtggaggagt
tttgtcgccagcttccccagtgtgaccctgagtcaaccagcctccccagagaccttgttg
gacaccaacaactaa

DBGET integrated database retrieval system