KEGG   Mus musculus (house mouse): 69864
Entry
69864             CDS       T01002                                 
Symbol
1810065E05Rik, AV047390
Name
(RefSeq) RIKEN cDNA 1810065E05 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PLA2_inh
Other DBs
NCBI-GeneID: 69864
NCBI-ProteinID: NP_081515
MGI: 1917114
Ensembl: ENSMUSG00000013653
UniProt: Q9D8K1 Q5NC41
Position
11:58311937..58316849
AA seq 235 aa
MFWSSVSKSLLAVCVVTEFAVIFVESLSCENSMCTNGLCQPMGTCNTSKSCFSQTQEFKM
PELSTSLSVQQKGCSLDECTGLAFSATLGDQRTFRYDQRCCTTDKCNQVDTKPSQVPAKA
NGVQCLACYMEAGRVCIPTPLKCTGSETKCVAVIGTAVGSSSPLSVVMVGSGCATESACN
LNMTVLDFVNIRTFCSSGFPVLPTPSSAPDGLGLRSASISTVPVLISLLLLKVLV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgttctggtcttcagtatcgaagagcctccttgctgtctgtgttgtcacggagtttgct
gtgatctttgtggagagtctctcttgtgaaaactctatgtgcacaaatggactctgtcag
cccatgggtacatgcaatacctctaaaagctgcttcagccaaacacaggaatttaaaatg
ccagagctgtccacaagcctaagtgtccagcagaaaggctgttctctagatgaatgtact
ggactggcattctcggcgacactgggggaccaacggacatttagatatgaccagcgatgc
tgtactactgataagtgcaatcaagtggacacgaaaccatctcaggtacctgcaaaagcc
aatggtgttcagtgtcttgcctgctatatggaggcaggcagggtgtgtattccaactcct
ctgaagtgcacagggagcgagacgaagtgtgttgcagttataggcacagctgttggaagc
agtagtcccctttcggtagtgatggttggatctggctgtgcgacagaaagcgcctgtaac
ctgaatatgaccgttttggactttgtaaatatccgcaccttttgctccagtgggttccct
gtacttccaaccccctcgtcagctccggatggcttgggccttcgatctgcatccatctca
acagtgccagttctgattagtctcctcttgctgaaagtcttggtttga

DBGET integrated database retrieval system