KEGG   Mus musculus (mouse): 69894
Entry
69894             CDS       T01002                                 

Symbol
Fam241b, 2010107G23Rik, AA545165
Name
(RefSeq) family with sequence similarity 241, member B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4605
Other DBs
NCBI-GeneID: 69894
NCBI-ProteinID: NP_081527
MGI: 1917144
Ensembl: ENSMUSG00000020083
Vega: OTTMUSG00000032742
UniProt: Q9D882
Position
10; 10 B4
AA seq 120 aa
MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGPGPRQQQAGARLGAAQ
SPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
NT seq 363 nt   +upstreamnt  +downstreamnt
atggtgaggatcttggccaatggggagatcgttcaggatgatgacccacgagtgaggacg
accacccagcacagaagtagcagctctcagcagggctttttcaacagaggccacggcgca
cctccagggggccctggaccccgccagcagcaggcaggtgcccgactgggtgctgcccaa
tctcctttcagtgacctgaaccggcagctggtgaacatgggcttcccacaatggcacctt
gggaaccacgtggtggaacctgtgacctccatcctcctgctcttcctgcttatgatgctc
ggggttcgtggcctcctgcttgtgggcctggtctacctggtgtctcacctgagtcagcgg
tga

DBGET integrated database retrieval system