KEGG   Mus musculus (mouse): 69900
Entry
69900             CDS       T01002                                 

Symbol
Mfsd11, 2600014M03Rik
Name
(RefSeq) major facilitator superfamily domain containing 11
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: UNC-93 MFS_1
Other DBs
NCBI-GeneID: 69900
NCBI-ProteinID: NP_848735
MGI: 1917150
Ensembl: ENSMUSG00000020818
Vega: OTTMUSG00000003791
UniProt: Q8BJ51
Position
11; 11 E2
AA seq 449 aa
MSPESKKLFNIVILGVAFMFMFTAFQTCGNVAQTVIRSLNSTDFHGSGYTSLAIIYGVFS
ASNLITPSVVAIVGPQISMFVSGLFYSMYIAVFIQPFPWSFYTASVFIGIAAAVLWTAQG
NCLTINSDEHTIGRNSGIFWALLQSSLFFGNLYIYFAWQGKTQISEHDRRTVFIALTVIS
LVGTVLFFLIRKPDPENVLGEEESCDDQDMEATESAQNNVTKAVDAFKKSLRLCVTREML
LLSVTTAYTGLELTFFSGVYGTCIGAVNKFGTEEKSLIGLSGIFIGIGEILGGSLFGLLS
KNSRFGRNPVVLLGTLVHFVAFYLIFLNMPGDAPIAPVEGTNSIAYIRPSKEVAILCSFL
LGLGDSCFNTQLLSILGFLYSEDSAPAFAVFKFVQSICAAVAFFYSNYLLLHWQLLVMVI
FGFFGTISFFAVEWDAAAIVARGSDYRSI
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgtccccggagtctaaaaagcttttcaacatcgttattttaggagttgcctttatgttt
atgttcaccgcctttcagacttgtggaaatgtggcgcaaactgtcatcaggagcttaaat
agcacagattttcatggcagtggatataccagcttggcaattatttatggcgtgttctct
gcttcaaatttgatcactccgtccgtggtcgccattgttggacctcagatctctatgttt
gtcagtggtttgttttacagcatgtacattgccgtttttatccagcctttcccatggtcc
ttctacacagcatctgtcttcatcggaattgccgctgctgtcctttggacagcacaagga
aattgcctgacgataaattctgatgagcacacaatcgggagaaacagcggaattttctgg
gcactcttacagtctagcttgttctttgggaatctctacatatattttgcatggcaaggg
aagacccagatctcagagcatgaccgaaggacagtgtttattgctctgacagtgataagc
ctcgtggggaccgttctgttctttctcattcggaaaccagatcctgagaatgtccttgga
gaagaagagtcttgcgatgaccaggacatggaagccaccgagtctgcccagaacaacgtg
acaaaggcagtcgatgcgtttaaaaagtctctgaggctgtgtgtcaccagggagatgctg
ctcctgagcgtcacgactgcctacacaggtctggagctgaccttcttctctggggtgtac
ggtacctgtattggggccgtaaacaaatttgggacagaagagaaaagcctcattggactt
tctggaattttcatcggcattggagagattttaggtgggagcctcttcggcctgctgagc
aagaacagtcgctttggcaggaacccggtcgtgctgctcggcaccctggtgcacttcgta
gccttctacttgatctttctcaacatgcccggagacgcgcccattgcccctgtggaaggg
accaacagcattgcatacatcaggcccagcaaagaagttgccattctctgcagttttctg
ctgggtctgggagacagctgcttcaacacccagctgcttagcattctgggttttctctac
tcggaagacagcgcgccggccttcgcggtctttaagtttgttcagtcaatctgcgcagcc
gtggcctttttctacagcaactacctcctcctccactggcagctcctggtcatggtgata
tttgggttttttggaaccatttctttcttcgctgtggagtgggacgctgctgccatcgtg
gcccgaggctcggactaccgaagcatttga

DBGET integrated database retrieval system