KEGG   Mus musculus (mouse): 69903
Entry
69903             CDS       T01002                                 

Gene name
Rasip1, 1110025D03Rik, 2610025P08Rik, AI853551, Rain
Definition
(RefSeq) Ras interacting protein 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DIL RA
Other DBs
NCBI-GeneID: 69903
NCBI-ProteinID: NP_082820
MGI: 1917153
Ensembl: ENSMUSG00000044562
Vega: OTTMUSG00000029506
UniProt: Q3U0S6 Q8CCF1
Position
7; 7 B3
AA seq 961 aa
MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPL
PPPPPPPHVELRRVGAVKAAGGASGSRAKRISQLFRGSGAGGAGGPGTPGGAQRWASEKK
LPELAAGVAPEPPLPTRAAVPPGVLKIFASGLASGANYKSVLATERSTARELVAEALERY
GLTGGRGAGDSGCVDAYALCDALGRPAVGVGGGEWRAEHLRVLADAERPLLVQDLWRARP
GWARRFELRGREEARRLEQEAFGAADADGTNAPSWRTQKNRSRAASGGAALASPGPGSGS
GTPTGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQMVPTDPGDF
DQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGPSSSRGGSPAPYVDT
FLNAPDILPRHCTVRAGPEPPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFM
YKDPRSGGSGPARPSWLPARPGAAPPGPGWAFSCRLCGRGLQERGEALAAYLDGREPVLR
FRPREEEALLGEIVRAAASGAGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLI
KEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPLILWMANTTELLSFVQEKVLE
MEKEADQEGLSSDPQLCNDLELCDEALALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSN
PFTAGAELPGPGAELEAMPPGLRPTLGVFQAALELTSQCELHPDLVSQTFGYLFFFSNAS
LLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIATEFFRKLSIAVNLLCVP
RTSLLKASWSSLRTDYPTLTPAQLHHLLSHYQLGPGRGPPPAWDPPPAERDAVDTGDIFE
SFSSHPPLILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANHRHGPPVAST
P
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgctatctggtgaacgaaaggagggcggaagcccccgcttcgggaagctccatcttcca
gtgggcctgtggatcaattccccaaggaaacagctcgccaaactggggcggcgctggccc
agcgctgcctctgtcaagtcctcgtcctccgacacggggagccgaagcagcgagcccctg
ccgccgccgccgccgccgccgcacgtggagctgcggcgcgtaggtgcggtgaaggcggcg
gggggagcgtcgggcagccgagccaagcgcatctcgcagctgtttcggggctcaggggcc
ggcggcgccgggggtcctggcacgcctgggggcgcgcagcgctgggccagcgagaagaag
ctgcctgaactggcggcgggtgtagctccggagcccccgttgcccacgcgtgccgcggtg
cccccgggagtgctcaagatcttcgcttctgggctggcgtcgggcgccaactacaagagc
gtgctggctacggagcgatccaccgcgcgcgagctggtggcggaggcgctggagcgctac
gggctgacgggcggccgcggagcgggcgacagcggctgcgtggacgcctacgcgctttgc
gacgctctgggccggcccgcggtcggcgtgggcggaggcgagtggcgtgccgagcacctg
cgggtgttggccgacgcggagcgccctctgctggtgcaggacctgtggcgcgcccgtccg
ggctgggcgcggcgctttgagctgcgcggccgcgaggaggctcgacggctggagcaggag
gccttcggggctgcggatgcagacggcacaaacgccccatcttggcggacccagaagaat
aggtctcgggcagcatctggcggggcagctctggccagtcctggtccaggatcaggatcc
gggacccccactgggtccgggggcaaggagcgatctgaaaatttgtctctgcgtcgaagc
gtgtctgagctgagtctacaggggcggaggcgaaggcagcaggaacgcaggcagcaggcc
cttagcatggccccaggggcagctgatgctcagatggtaccaacggaccctggagacttc
gatcagttgactcagtgcctcattcaggcacccagcaaccgtccctacttccttctgctc
cagggctaccaggatgctcaggacttcgtggtgtatgtcatgacacgagagcagcacgtg
ttcggccggggtgggccctcctcgtcccgcgggggatccccagccccatatgtggacacc
ttcctcaacgccccagacatcctgcctcgacattgcacggtgcgcgcgggccctgagccc
ccggccatggtgcgcccatcccggggcgcccccgtcacacacaatggctgtcttttgctg
cgggaggcagagctgcaccccggagacctgttaggcctaggagagcatttcctgttcatg
tacaaggacccccgctccgggggttctgggcccgctcggccatcttggctgccagcgcgc
cccggggccgcgccacccggaccgggctgggccttttcttgtcgtttgtgtggccgtggc
ctgcaggagcgcggcgaggcgctggccgcctacctggatggccgcgagccggtgctgcgg
ttcagaccacgagaggaagaggcgctgttgggcgagatcgtgcgagctgcagcctcggga
gcaggggacctgcccccgctcgggccagccactctgctggcactgtgtgtgcagcattct
gcgagggagctggagctgggccacctgcctcgcttgctgggccgcctggcccggctcatc
aaagaagccgtttgggaaaaaattaaagaaattggagaccgccagccagagaaccaccca
gagggagttcccgaggtgcctctgacccctgaggctgtgtctgtggagctgcgaccactc
atactatggatggccaacaccacagagctgttgagctttgtacaggagaaagtgctagag
atggagaaggaggctgaccaggagggcctgtcctcggacccacagctctgcaatgacttg
gaactgtgtgatgaggccttggccctcctggatgaggtcatcatgtgtactttccagcag
tcggtctactacctcaccaagactctttattcaacactgccagctctcctggacagtaac
cctttcacagctggagcagagctgccagggcctggcgcagagctggaggccatgccgcct
gggctcaggcctactctgggtgtgttccaggcagctctagaactgaccagtcagtgtgag
ctgcatcccgacctcgtgtcccagacttttggctatttgttcttcttctccaatgcatcc
cttctcaactcactgatggaacgaggtcaaggccgacctttctatcaatggtctcgagcc
gtccaaatcagaaccaacttggatcttgtgttggattggcttcagggggccgggctgggt
gacattgccactgagttcttccggaaactttccattgctgtgaacctgctatgtgtgccc
cgcacctccctgctcaaggcttcatggagcagcttacggactgactaccccaccctgact
ccagctcagctccaccatctcctcagccactaccagttgggtcctggccgtggtccccca
ccagcctgggacccaccacctgcagagcgggatgctgtggacacaggggatatctttgaa
agtttttcctcgcaccctccgctcatcctgcccctgggcagctcacgcctgcgcctcacc
ggccctgtgacagatgacgcattgcatagagaactgcgcaggctccgtcgcctcctctgg
gatcttgaacagcaggagctgccagccaatcatcgccatggacccccggtggcttcgaca
ccttga

DBGET integrated database retrieval system