KEGG   Mus musculus (house mouse): 69908
Entry
69908             CDS       T01002                                 
Symbol
Rab3b, 2610528C18Rik
Name
(RefSeq) RAB3B, member RAS oncogene family
  KO
K06108  Ras-related protein Rab-3B
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69908 (Rab3b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    69908 (Rab3b)
   04031 GTP-binding proteins [BR:mmu04031]
    69908 (Rab3b)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    69908 (Rab3b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   69908 (Rab3b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    69908 (Rab3b)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 GTP_EFTU Gtr1_RagA Fin AAA_24 AAA_16
Other DBs
NCBI-GeneID: 69908
NCBI-ProteinID: NP_076026
MGI: 1917158
Ensembl: ENSMUSG00000003411
UniProt: Q9CZT8 Q0PD62
Position
4:108736267..108800521
AA seq 219 aa
MASVTDGKTGIKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFK
VKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQI
KTYSWDNAQVILVGNKCDMEEERVVPTEKGRLLAEQLGFDFFEASAKENISVRQAFERLV
DAICDKMSDSMDTDPSVLGASKTTRLSDTPPLLQQNCSC
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcttcagtgactgatggtaagactggaatcaaagatgcctccgaccagaactttgac
tacatgttcaaactgctcatcattggcaacagcagcgtcgggaagacctccttccttttc
cgctatgctgatgacaccttcacccctgcctttgtcagcactgtgggtatcgacttcaaa
gtgaagacagtctaccgccatgagaagcgtgtgaagctgcagatatgggacacagctggg
caagagcggtaccggaccatcaccacagcctactaccgtggggccatgggcttcattctc
atgtatgacatcaccaacgaggagtccttcaatgctgtccaggactgggctactcagatt
aagacctactcctgggacaacgcacaggtcattctcgtgggaaataagtgtgacatggaa
gaggaaagagtggtcccaactgagaagggccggctcctggcagaacagcttgggtttgac
ttctttgaagccagcgccaaggagaacatcagtgtgaggcaggccttcgagcggctggtg
gatgccatctgcgataagatgtctgactcgatggacacagacccctccgtgctaggcgcc
tccaagacgacgcggctctcagacaccccacctctgctgcagcagaactgctcttgttag

DBGET integrated database retrieval system