KEGG   Mus musculus (mouse): 69912
Entry
69912             CDS       T01002                                 

Gene name
Nup43, 2610016K01Rik, 2610529I12Rik, 43kD, AA409950, p4, p42
Definition
(RefSeq) nucleoporin 43
  KO
K14305  nuclear pore complex protein Nup43
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    69912 (Nup43)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    69912 (Nup43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    69912 (Nup43)
   03036 Chromosome and associated proteins [BR:mmu03036]
    69912 (Nup43)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     69912 (Nup43)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    69912 (Nup43)
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 69912
NCBI-ProteinID: NP_663752
MGI: 1917162
Ensembl: ENSMUSG00000040034
Vega: OTTMUSG00000034979
UniProt: P59235
Position
10; 10 A1
AA seq 380 aa
MEEIYAKFVSQKISKTRWRPVPSGSLQTTETFATGSWDNEENCVSLWSIGDFGNLDSDGG
FEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWPAAHY
HTGPSSPSYSSAPCTGIVCDNPEIVTVGEDGRINLFRVDHKEAVRTIDNADSSTLHAVTF
LRTPEIVTVNSIGQLKIWDFRQQGSEPCQILSLTGDRVPLHCVDRHPDQQHVVATGGQDG
MLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPDHLFTCSEDGSLWHWDASTDAPEKSS
LFHQGGRSSTFLSHSLSNQAGVHQSLVSSWLSTDPAKDRIEITSLLPSRTLSVNSLDVLG
PCLVCGTDAEAIYVTRQLFS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggaggaaatttatgctaagttcgtgtctcagaaaattagcaaaacccgctggcggcca
gtgccttccgggagcctgcagaccacagagacctttgccacgggctcttgggacaatgag
gaaaattgcgtttcactgtggtctattggagattttggaaacttggattctgacggaggg
tttgaaggagaccatcagttactgtgcgatattagacatcatggggatgtcatggattta
cagttttttgaccaggaaagaattgtagctgcttcgtcaacaggctgtgtaacagttttt
cttcaccatccaaataaccagaccctgtccgtcaatcagcagtggcctgcagctcattac
catacaggtcccagcagtccctcctatagcagtgcaccatgtacaggaattgtgtgtgac
aacccagaaattgttacagttggagaggatggccgaataaatctcttcagagttgatcac
aaggaggctgtcagaactatagataatgcagacagcagtacactccatgccgtaaccttc
cttcgaactcctgagattgttacagtaaattcaattggacagttaaaaatatgggatttc
agacaacaaggaagtgaaccctgtcagatactatcactgactggtgaccgagtgccactc
cactgtgttgacagacatccagaccagcagcatgttgtagctaccggtggccaggatgga
atgttgagtatttgggatgtcagacaaggtaccatgcctgtgtcattactgaaggctcat
gaggctgaaatgtgggaggttcacttccacccgtccaacccagatcacctgttcacttgt
tctgaagatggatctctctggcattgggatgcctccacagatgcacctgaaaagtcttct
ctctttcaccaaggaggaagaagtagtactttcctgtcacatagcttaagtaaccaggcc
ggtgttcaccagtctctagtaagttcctggctcagcacagaccctgccaaagaccgaatt
gaaatcacaagcttgcttcccagcaggactctgtctgtaaacagtttggatgttttaggt
ccctgtcttgtttgtggaactgatgcagaagccatttatgttaccagacaactattttca
tga

DBGET integrated database retrieval system