KEGG   Mus musculus (mouse): 69920
Entry
69920             CDS       T01002                                 

Gene name
Polr2i, 2810002B19Rik
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide I
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    69920 (Polr2i)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    69920 (Polr2i)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69920 (Polr2i)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69920 (Polr2i)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     69920 (Polr2i)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      69920 (Polr2i)
SSDB
Motif
Pfam: RNA_POL_M_15KD TFIIS_C Zn_ribbon_recom DZR Ogr_Delta DUF3716 TF_Zn_Ribbon
Other DBs
NCBI-GeneID: 69920
NCBI-ProteinID: NP_081535
MGI: 1917170
Ensembl: ENSMUSG00000019738
Vega: OTTMUSG00000023328
UniProt: P60898
Position
7; 7 B1
AA seq 125 aa
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
NT seq 378 nt   +upstreamnt  +downstreamnt
atggaacccgacgggacgtacgagcctggcttcgtgggtattcggttctgccaggaatgt
aataacatgctgtaccccaaggaggacaaggaaaatcgcattctgctgtacgcgtgccgg
aattgcgattaccagcaggaagccgacaacagctgcatctacgtcaacaaaatcacgcac
gaagtggacgagctgacccagatcatcgcagacgtgtcccaggaccccacgttgccccgg
acggaggaccacccgtgccagaagtgtggccacaaggaggcagtgttctttcagtcacac
agtgcccgagctgaggacgccatgcgcctgtactatgtttgcactgccccacactgcggc
caccgctggactgagtga

DBGET integrated database retrieval system