KEGG   Mus musculus (mouse): 69922Help
Entry
69922             CDS       T01002                                 

Gene name
Vrk2, 2810003O05Rik, AI447698
Definition
(RefSeq) vaccinia related kinase 2
  KO
K08816  vaccinia related kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    69922 (Vrk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     69922 (Vrk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CK1 group
  VRK family
   69922 (Vrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 69922
NCBI-ProteinID: NP_081536
MGI: 1917172
Ensembl: ENSMUSG00000064090
Vega: OTTMUSG00000008090
UniProt: Q8BN21
Position
11; 11 A3.3
AA seq 503 aa AA seqDB search
MAPRRKEKYKLPVPLPEGKILDDMEGNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVI
KLEYQENGPLFSELKFYQRAAKRECIQKWIQQRKLDYLGIPVFYGFGLTDFKGRSYRFMV
MERLGIDLQKLLDQNGGFKKLTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLDFTNPD
RVYLADYGLSYRYCPNGNHKQYQEDPRKGHNGTIEFTSLDAHKGVAPSRRSDVEILGYCM
LHWLFGKLPWEAKLDDPVAVQTAKTNLLDELPESVLKWAPSGSSCSELVKYLMYVHNLAY
DDKPDYQKLKKILNPDGVPLGPLEFSTKVQSVHVRTPAQQKVDSPKATRKPANEFPAKFP
KKVHRETRARQREEQEDSQPTMLQSRPAAPENSRTRKIHEYSDIFSEMQSLQQTPSYMSF
QGSYCKPYLDCTRRDPIRKPRSLPRYRHTPTGNLGVTDLESSPRFWPAIFQLTLSEETKA
DVYYYGITIFCLLIFVFLALYFL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaagaagaaaagagaaatataagcttccggttccactcccagaaggcaaaatt
ctggatgatatggaaggaaaccggtgggcactgggcaagatgatcggctctggagggttt
ggactgatatacttagctttccccacaaataaaccaaacaaagatgcaagacatgtcata
aagctggagtatcaagaaaatggcccattattttcagagcttaaattttatcagagagct
gcaaaaagagaatgtatccaaaagtggatacaacagaggaaacttgattatttaggaatt
cctgtattttatggatttggtctgactgatttcaaaggaagaagttacagattcatggta
atggaaagacttggaatagatttacagaaactcctggaccagaatggtggttttaaaaaa
ttaaccgtcctacaacttggcatcaggatgctggatgtactggaatatatacatgaaaat
gagtatgttcatggtgatataaaagccgcaaatctactgttggattttacaaatccagac
cgggtttatcttgcagactatggactttcctacagatattgtcccaatgggaaccacaaa
cagtatcaggaagatcccagaaagggccataatgggacaatagagtttacaagtttggat
gcacacaaaggagtggccccgtccaggaggagtgatgttgaaatccttggttactgcatg
ctgcactggctcttcgggaagcttccttgggaagcaaagctggacgaccctgtggctgtc
cagactgctaaaaccaacctgctggatgaactcccagagtcggtgcttaagtgggctcct
tctggaagcagttgcagtgaacttgtcaagtacttgatgtatgttcataatttagcttat
gatgacaagccagactatcagaagctcaagaaaattttgaatccagatggagtaccttta
gggccactggaattttccactaaagtacagagtgtccatgtgcggactccagcccaacaa
aaagttgattcaccaaaggctacaagaaaaccagccaatgagttcccagctaagttccca
aagaaagtccacagggagacaagagcaaggcagagagaggagcaggaagacagccagccc
acaatgctgcagagcaggccggcagcaccggaaaactcaaggacaaggaaaatacatgaa
tattctgatattttcagtgagatgcagagtcttcaacaaacacccagctatatgagtttc
caaggttcatattgcaagccctatctggactgcactagaagagatcccatcaggaagcca
agatccctgcctcggtacagacacacgcccacgggtaatctgggagtcacagacttggaa
agttctccaaggttttggcctgcaatttttcagttgactctgagtgaagagacaaaggca
gatgtgtattactatgggatcactatattctgtctgctgatatttgtatttcttgctttg
tattttctctga

DBGET integrated database retrieval system