KEGG   Mus musculus (mouse): 69923
Entry
69923             CDS       T01002                                 

Gene name
Agk, 2610037M15Rik, 6720408I04Rik, AI465370, MuL, Mulk
Definition
(RefSeq) acylglycerol kinase
  KO
K09881  acylglycerol kinase [EC:2.7.1.94]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    69923 (Agk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.94  acylglycerol kinase
     69923 (Agk)
SSDB
Motif
Pfam: DAGK_cat Tim54 NAD_kinase Peptidase_S51
Other DBs
NCBI-GeneID: 69923
NCBI-ProteinID: NP_076027
MGI: 1917173
Ensembl: ENSMUSG00000029916
Vega: OTTMUSG00000056333
UniProt: Q9ESW4
Position
6; 6 B1
AA seq 421 aa
MTAFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTVVKTDYEGQAKKLLELMESTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGQTSSLSHTLFAESGNKVQHITDATL
AIVKGETVPLDVLQIKGEKEQPVYAMTGLRWGSFRDAGVKVSKYWYLGPLKTKAAHFFST
LQEWPQTHQASISYTGPRERPPIEPEETPPRPSLYRRILRRLASFWAQPQDASSREVSPE
VWKDVQLSTIELSITTRNTQLDLMSKEDFMNICIEPDTVSKGDFIIIGSKKVRDPGLRAA
GTECLQASHCTLVLPEGTEGSFSIDSEEYEAMPVEVKLLPRKLRFFCDPRKREQMLPSTS
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgactgcattctttaaaacgcttcgaaatcattggaagaaaactacagctgggctctgt
ttgctgacatggggaggtcactggctctacgggaagcactgtgataacctgctaagaaga
gcagcctgtcaagaagctcaggtgtttggcaaccagctcattcctcccaatgcacaagtg
aagaaagccaccgtctttctcaatcccgcagcttgcaaaggcaaagccagaactctattt
gaaaaaaatgctgctccaattttacacctgtctggcatggatgtgactgttgtcaagacg
gattatgagggacaagccaagaagctcttggagttgatggaaagcactgatgtgatcatt
gttgctggaggagacggcacactgcaggaggttgttactggagtactgagaagaacagat
gaggctaccttcagtaagattcccattggatttatcccgctgggacagaccagtagtttg
agtcacactctctttgctgaaagtggaaacaaagtccaacatattacagacgccacactt
gccattgtgaaaggagagactgttccacttgatgtcttgcagatcaagggtgaaaaagaa
caacctgtgtatgcaatgactggcctccggtggggatctttcagagatgctggcgtcaaa
gttagcaagtactggtatcttggtccactaaaaaccaaagcagcccactttttcagcact
cttcaggaatggcctcagactcatcaagcctccatctcttacacgggacctagagagaga
cctcccattgagcctgaagagactcctcccaggccgtctctgtataggagaatattacgc
aggcttgcctcattctgggcacagccacaggatgcctcctcccgagaggtaagccctgag
gtctggaaagatgtacaactgtccaccattgaactgtccatcacaacccgaaacacccaa
cttgacctgatgagcaaagaggattttatgaacatttgcattgaacctgacactgtcagc
aaaggagatttcataatcataggaagtaagaaggtgagagaccctggcctgcgtgcagct
ggcaccgagtgcctccaagccagccactgtactctggttcttcctgagggaactgagggc
tccttcagcattgacagcgaggagtacgaagccatgccggtggaggtcaaactactgccc
agaaagctgcggttcttctgtgatccgaggaagagagagcaaatgctgccgagcacatcc
cagtga

DBGET integrated database retrieval system