KEGG   Mus musculus (house mouse): 69940
Entry
69940             CDS       T01002                                 
Symbol
Exoc1, 2810407P21Rik, A730011E05Rik, SEC3, Sec3l1, Sec3p
Name
(RefSeq) exocyst complex component 1
  KO
K19983  exocyst complex component 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69940 (Exoc1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    69940 (Exoc1)
SSDB
Motif
Pfam: Sec3_C Sec3-PIP2_bind FlaC_arch
Other DBs
NCBI-GeneID: 69940
NCBI-ProteinID: NP_001276699
MGI: 2445020
Ensembl: ENSMUSG00000036435
UniProt: Q8R3S6 Q6P1Y9
Position
5:76677147..76718145
AA seq 894 aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDK
GDFYKRQIAWALRDLAVVDAKDAIKENPEFDLHFEKVYKWVASSTAEKNAFISCIWKLNQ
RYLRKKIDFVNVSSQLLEESVPSGENQSVAGGDEEAVDEYQELNAREEQDIEIMMEGCEC
AISNAEAFAEKLSRELQVLDGANIQSIMASEKQVNTLMQLLDEALTEVDQIELKLSSYEE
MLQSVKEQMDQISESNHLIHLSNTNNVKLLSEIEFLVNHMDLAKGHIKALQEGDLVSSRG
IEACTNAADALLQCMNVALRPGHDMLLAVKQQQQRFSDLREHFARRLASHLNNVFVQQGH
DQSSTLAQHSVELTLPNHHPFHRDLLRYAKLMEWLKSTDYGKYEGLTKNYMDYLSRLYER
EIKDFFEVAKMKMTGTSKESKKFATLPRKESAVKQETESLHGSSGKLTGSTSSLNKLSVQ
SSGSRRSQSSSLLDMGNMSASDLDVADRTKFDKIFEQVLSELEPLCLAEQDFISKFFKLQ
QHQNMSASMTEAEDLDGGSLLRQHSSGTLLPVSSEKDMIRQMMIKIFRCIEPELNNLIAL
GDKVDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCISNQIRQMEE
VKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFINVEKVANES
QKTPRDVVMMENFHHIFATLSRLKISCLEAEKKEAKQKYTDHLQSYVIYSLGQPLEKLNH
FFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEE
NLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgacagcaatcaagcatgcgctgcagagagatatcttcacaccaaatgatgaacgcctg
ctgagcatcgtgaatgtctgcaaagctggcaagaagaagaagaactgttttctgtgtgcc
acagtgaccactgaacgccccgtgcaggtgaaggtggtcaaagtcaagaaatccgacaag
ggagatttctacaaaaggcagattgcttgggccctgcgagaccttgctgtggtcgacgcc
aaagatgccatcaaagaaaacccggaatttgatttgcattttgagaaggtctataagtgg
gtggccagcagcacggctgagaagaacgccttcatctcctgcatttggaagctgaaccag
cgctacctgcgcaagaaaatcgactttgttaatgttagctcgcagcttttggaagaatct
gttccaagcggagagaatcagagtgtagcgggaggggatgaagaagcggtagatgagtac
caagagttaaatgcaagagaagagcaggacatcgagataatgatggaaggctgcgagtgc
gccatttctaacgctgaagcctttgcggagaagttgtcccgggagctgcaggtgctcgat
ggggccaacattcagtcaatcatggcctctgagaaacaagtgaacaccctgatgcagttg
ctggatgaggcgctaacggaggtggaccagattgaactgaaactgagcagttacgaggag
atgctccaaagtgtgaaagagcagatggatcagatctctgagagcaaccacctgatccat
ctcagcaacacgaataatgtgaagctcctgtccgagatagagttcctcgtgaaccacatg
gacttggccaaaggtcatataaaggcccttcaggaaggagatcttgtttcttcccgaggc
atcgaggcctgcaccaacgctgctgacgccctgctgcagtgcatgaacgttgctcttcgc
ccaggccatgacatgctcctggccgtcaagcagcagcagcagcgcttcagtgacctgagg
gaacatttcgcccggagactggccagccatctcaacaatgtttttgttcaacagggtcat
gatcagagttcaactcttgctcagcactctgttgaactgactctacccaatcaccatcca
tttcatagagacttgctccgctatgccaagctgatggagtggctaaagagtacagactat
ggaaaatacgagggactaacaaagaattacatggattatttatcccgactatatgaaaga
gaaatcaaagatttctttgaagttgcaaagatgaagatgactggcacctctaaagaaagc
aagaagtttgctacactgcctcgaaaagaaagtgctgtcaagcaggaaacagagagtctc
catggaagctctgggaaactcactggatcaacttctagtctgaataaactcagtgttcag
agctcgggcagtcgcaggtcccagtcgtcctccctactggacatggggaacatgtctgcc
tctgacctcgatgtggctgacagaaccaagtttgataagatctttgaacaggtgctgagt
gaactggagccactgtgtctggcagaacaggacttcataagtaaatttttcaaactacag
cagcatcaaaacatgtctgcatcaatgactgaagcagaagacctggatggaggctcgtta
ttacggcagcacagttctggcaccctgctccctgtttcctctgaaaaagatatgattcgc
caaatgatgatcaaaatattccgttgcattgaaccagaactgaacaacctaattgcatta
ggagacaaagtagatagctttaactccctgtacatgctggtcaaaatgagtcaccacgtg
tggaccgcacagaacgtggacccagcatcttttctaagtactacattaggaaacgttttg
gtgactgtgaagaggaactttgacaaatgcattagtaaccaaataagacaaatggaagaa
gtaaagatctcaaagaaaagtaaagtaggaattcttccatttgttgctgaatttgaagaa
tttgctgggctcgcagaatcaattttcaaaaatgctgaacgccgtggcgatctggacaaa
gcatacaccaaattaatcagaggagtgttcattaatgtggagaaagtagcaaatgagagc
cagaagacgcccagggatgtggtcatgatggagaactttcaccatatttttgcaacactt
tctcgtctgaaaatctcatgtcttgaagctgagaagaaagaagccaagcagaagtacacg
gatcaccttcagtcctacgtcatttactctttaggacagccccttgaaaagctaaatcat
ttctttgaaggcgttgaagctcgagtagcccagggcattcgggaggaggaggtgagctac
cagcttgcgttcaacaagcaagagcttcgcaaagtcattaaagagtatccaggcaaggag
gtgaagaagggcctggacaacctctacaagaaggtagacaagcacctgtgtgaggaggag
aacttactgcaggtggtgtggcactccatgcaagatgagtttatacgccagtacaagcac
ttcgaggggttgatagcgcgctgctaccctggatctggagttacgatggaattcactatt
caggacattctggattattgctccagcatcgcacagtcccactaa

DBGET integrated database retrieval system