KEGG   Mus musculus (mouse): 69957
Entry
69957             CDS       T01002                                 

Gene name
Cdc16, 2700071J12Rik, 2810431D22Rik, APC6
Definition
(RefSeq) CDC16 cell division cycle 16
  KO
K03353  anaphase-promoting complex subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    69957 (Cdc16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    69957 (Cdc16)
   04114 Oocyte meiosis
    69957 (Cdc16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    69957 (Cdc16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    69957 (Cdc16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    69957 (Cdc16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    69957 (Cdc16)
   03036 Chromosome and associated proteins [BR:mmu03036]
    69957 (Cdc16)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     69957 (Cdc16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     69957 (Cdc16)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    69957 (Cdc16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 SRP_TPR_like Dynein_light
Other DBs
NCBI-GeneID: 69957
NCBI-ProteinID: NP_081552
MGI: 1917207
Ensembl: ENSMUSG00000038416
Vega: OTTMUSG00000031373
UniProt: Q8R349 Q3TI84
Position
8; 8 A1.1
AA seq 620 aa
MNLEPLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDILDMEEPINRRLFEKYLKDDNGSRDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLDSLPLNKLCAEEQELLRFVFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSTVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVIHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFRDFEVEKQNTEEAGLAPLQNSTKAPESRPNLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacctggagccgctgcgcaaacgcgtccggcagtacctggaccagcaacagtatcaa
agtgctctgttttgggcagacaaggtagcttcactctctcatgaggagccccaggatgtt
tattggttggctcagtgcctttacctcacagcgcagtaccaccgagcagcccatgcgctc
cggtcacgcaagctggacaaattgtatgaagcttgccgataccttgcagctagatgccac
tatgctgcaaaagagcaccagcaggctctggacatccttgacatggaggagccaattaac
agaaggctctttgagaaatacctgaaggatgacaatggctcgagagacccttccagtgac
tgggagatgtcacagtcttccataaagagctcgatttgtctcctgagagggaagatctat
gatgctttagataatcgcaccctggctacctacagttacaaagaggctctgaaactggat
gtctactgctttgaagcctttgaccttttgacatcacaccacatgctgacagcacaggaa
gaaaaagaacttctggactccctgcctcttaacaagctctgtgctgaagaacaagagttg
ctgcgatttgtatttgagaacaaattaaagaagtataataagcccagtgaaacggtcatt
cccgagtcagtggacggcttgcaggagaatctggacgtggtagtgtctttagctgagaga
cactattacaactgtgattttaagatgtgctacaagcttacttctacagtgatggagaaa
gatcctttccatgcaaactgtttacctgtgcacataggaactcttgtggagctgaataaa
gcgaatgaacttttctatctttctcacaaactggtggatttatatccgagtaatcctgtg
tcttggtttgcggtgggatgttactatctcatggttggtcataaaaatgagcatgccaga
agatatctcagcaaagctaccacgttggagaagacctacggtcctgcctggatagcctac
gggcattccttcgctgtggagagtgagcacgaccaagcaatggctgcttacttcacagca
gcacagctgatgaaggggtgtcacttgccaatgctatatattggattagaatatggtctg
accaataactcgaaactggctgagcggttctttggccaagctctgagcatcgccccagaa
gacccatttgtcatccatgaggttggagtggttgcctttcagaatggagaatggaaaaca
gcagaaaaatggtttctcgatgctttggaaaaaattaaagcaattggaaatgaggtcaca
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaagaaa
tatgctgaggctttggattaccacaggcaggcactggtgctaatccctcagaacgcatcc
acctactctgctatagggtacatccacagtctgatgggcaactttgaaaacgctgtggac
tatttccacacagctcttggtctcaggcgagacgacacattttctgttacaatgcttggt
cactgcattgaaatgtacatcggggattcggaagcttatatcggagcagacattaaagac
aaattaaagtgctatgacttcgatgtgcatacaatgaaaacactaaaaaacatcatttcg
cctccatgggatttcagggactttgaagtagaaaagcagaacacagaggaagcgggactt
gcacctctgcaaaactccactaaagctccagagtccagacctaacttggaagagactttt
gaaattgaaatgaacgaaagtgacatgatgctagagacgtctatgtcagaccacagcaca
tag

DBGET integrated database retrieval system