KEGG   Mus musculus (mouse): 69983Help
Entry
69983             CDS       T01002                                 

Gene name
Sis, 2010204N08Rik, SI, Si-s
Definition
(RefSeq) sucrase isomaltase (alpha-glucosidase)
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    69983 (Sis)
   00500 Starch and sucrose metabolism
    69983 (Sis)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    69983 (Sis)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    69983 (Sis)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     69983 (Sis)
    3.2.1.48  sucrose alpha-glucosidase
     69983 (Sis)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   69983 (Sis)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 69983
NCBI-ProteinID: NP_001074606
MGI: 1917233
Ensembl: ENSMUSG00000027790
Vega: OTTMUSG00000035151
UniProt: F8VQM5
Position
3 E3; 3 32.59 cM
AA seq 1818 aa AA seqDB search
MAKKKFSGLEISLIVLFIIVTIIAIALVVVLATKVPAVEEVKSPTSTPSPGRCPPEQGEP
LNERINCIPEQHPTKAKCEERGCCWRPWNNTIIPWCFFADNHGYTAASVTNDNSGLKATL
SRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKLTDPNNKRYEVPHQFVKDGNGIPAADTLY
DVKVSENPFSIKVIRKSNNKVLFDTSIGPLVYSNQYLQISTRLPSEYIYGFGEHIHKRFR
HDLYWKTWPIFTRDEIPGDNNHNLYGHQTFFMGIEDNSGKSYGVFLMNSNAMEVFIQPTP
IITYRVTGGVLDFYIFLGDTPEQVVQQYQELIGRPAMPAYWNLGFQLSRWNYVSLDKVKE
VVRRNREAGIPYDAQVTDIDYMEDKKDFTYDEVAFKGLPEFAQDLHNHGQKYIIILDPAI
SINKRANGAEYQTYVRGNEQNVWVKESDGTTSLIGEVWPGLTVYPDFTNPRTWEWWANEC
NLFHQQVEYDGLWIDMNEVSSFIHGSQKGCAPNLLNYPPFTPGILDKIMYSKTLCMDAVQ
HWGNQYDVHSLYGYSMAIATEKAVEKVFPNKRSFILTRSTFAGSGHHAAHWLGDNTASWE
QMEWSITGMLEFGMFGMPLVGADICGFLANTTEELCRRWMQLGAFYPFSRNHNAEGYAEQ
DPAFWGADSLLVNTSRHYLTIRYTLLPFLYTLFYRAHAFGETVARPFLHEFYEDPNSWIE
DTQFLWGPALLITPVLRPETKYVSAYIPDATWYDYETGEKRPWRKQRVDMYLPEDKIGLH
LRGGYIIPTQQPDVTTTASRKNPLGLIVALDENQAAKGELFWDDGESKDTIEKKIYILYE
FSVSNNNLIVNCTHSSYPEGNTLVFKTIKVLGLSATVTAVTVGENDQQMNPHLAFTFDAF
NKILSITDLTFNLGKTFIVRWTTQSFSDNEKFTCYPDVGTATEKTCVERGCIWEPVSGLA
NVPPCYFPSNHNPYLLTSTQKLATGITAELQLNPASARIKLPSNPISTLRVEVKYHKNDM
LQFKIYDAHHKRYEVPVPLNIPDTPTSSEENRLYDVEIKENPFGIQVRRRSTGKLIWDSC
LPGFAFNDQFIQISTRLPSQYLYGFGEAEHTAFKRNLNWHTWGMFTRDQPPGYKLNSYGF
HPYYMALEDEGNAHGVLLQNSNGMDVTFQPTPALTYRTIGGILDFYMFLGPTPEGATKQY
HEVIGFPVMPPYWALGFQLCRYGYRNTSEIEQLYNDMKAAQIPYDVQYTDINYMERQLDF
TIGERFKTLPQFVEKIRKEGMKYIVILDPAISGNETQPYPAFERGIQKDVFVKWPNTNDI
CWAKVWPDLPNITIDETITEDEAVNASRAHVAFPDFFRNSTSEWWTREIYDFYNEKMKFD
GLWIDMNEPSSFVNGTVTNKCRNDTLNYPPYFPELTKRNEGLHFRTMCMETEHILSDGSS
VLHYDVHNLYGWSQVKPTLDALRNTTGLRGIVISRSTYPTAGRWGGHWLGDNYANWENLE
KSLIGMLEFNLFGIPYVGADICGFFNDSEYHLCARWMQVGAFYPYSRNHNIQFTRRQDPV
SWNETFAQMSKKVLEIRYTLLPYFYTQMHEAHIHGGTVIRPLMHEFFDDKETWEIYKQFL
WGPAFMVTPVIGPFQTAVNGYVPKARWFDYHTGEDIKVRGKLQTFSAPFDTINLHVRGGY
ILPCQEPAQNTYYSRQKYMKLIVAADDNQTAKGTLFWDDGESIDTYEKNQYTLIEFNLNQ
KNLTSTVLKDGYRNKSEMKLGSIYVWGKGTTSISQVNLTYGGNEQQLSFTQDEAKEILTI
DLKNVTVTLDEPIQISWS
NT seq 5457 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaaattcagtggattagaaatctctctgattgttctcttcatcatagta
acgataatagctatcgctcttgttgtggttttggctacaaaggtgcctgctgtggaagaa
gtaaaaagtccaacttcaacccctagtcctggaaggtgtccgcctgagcaaggtgaacct
ctcaatgagagaataaactgcattccagaacagcatccaacaaaggcaaaatgtgaagag
cgtggctgttgctggcgtccatggaacaacactattattccttggtgcttctttgcagat
aaccatggctatactgctgcgtcagtcacgaatgacaacagtggacttaaagccacactg
agcagaatcccttctcccactctatttggagaagacattaaaagcgtcctcctcacgact
cagagtcagacccgtaatcgtttccggttcaagctcacagatccaaataacaagagatac
gaagtgccacatcagtttgtaaaagatggaaatggaatcccagcagctgacacactgtat
gatgtcaaggtctcagaaaacccgttcagcatcaaagtcatcaggaaaagcaacaacaaa
gtcttgtttgataccagtattggtcctctggtgtactcaaaccaatatttgcagatttca
acaagacttccaagtgaatatatttatggctttggagaacatattcataagagatttcgt
catgacttatactggaaaacatggccaatctttactcgagacgagattcctggtgataat
aatcataatctctatgggcatcagacattcttcatgggcattgaagataactctggcaag
tcctatggtgttttccttatgaacagcaatgcaatggaggttttcatccagccaacacca
ataattacttacagagttactggtggcgtattagacttttatatatttcttggagacaca
ccagaacaagttgttcaacaatatcaagagctcattggacgaccagcaatgccagcatat
tggaaccttggctttcaactgagtcgctggaattacgtgtctttagataaagtgaaagaa
gtagtaagaagaaaccgggaagctggcatcccatatgatgcacaagtcactgatattgac
tacatggaagacaaaaaggactttacttatgatgaagtggcatttaaaggacttcctgag
tttgctcaggatttacataaccatggacaaaaatatattatcatcctggaccctgcaatc
tctataaacaaacgtgcaaatggtgccgaatatcaaacatatgtgagggggaatgagcaa
aatgtttgggtgaaagagtcagatggaaccacatcacttattggagaggtatggccagga
ttaacagtgtacccagattttactaatcccagaacctgggagtggtgggcaaatgaatgc
aatcttttccatcagcaagtggaatatgatggactctggattgacatgaatgaagtttcc
agctttatccacggttctcagaaaggatgtgctcccaatctactgaattaccctcctttt
actcccggtattcttgacaaaatcatgtactccaaaacgctttgcatggatgctgtgcag
cactgggggaatcagtatgatgtacacagcctgtatggatacagcatggctatagccaca
gagaaagctgtggaaaaagtttttcctaataagagaagcttcatccttacccggtcaaca
tttgctggttcgggacaccatgctgctcattggcttggagacaacacagcctcctgggag
cagatggagtggtccatcactggaatgctggagttcggcatgttcggtatgcctttggta
ggggcggacatctgtggatttttggctaacaccacagaagaactctgcagaagatggatg
caactgggagccttttatccattttctagaaaccacaatgctgaaggctatgcggaacaa
gatcctgccttttggggagcagactctcttttggtaaacacatcaaggcactacctaacc
atccgctacactttacttcccttcctctacactctgttctatagagcccacgcgtttggt
gagacagttgcaaggccatttcttcatgagttttatgaagacccaaacagctggattgag
gacacccagttcctgtggggccctgcactgctgatcactcctgttttgagaccagaaaca
aaatacgtgagtgcatatattcctgatgctacctggtatgattatgaaacaggtgaaaaa
agaccatggagaaaacaaagggttgacatgtaccttccagaagataaaataggattacat
cttagaggaggttatatcatccctacccagcaacctgatgtaacaacaacagcaagccga
aagaatcctctaggccttattgttgcattagatgaaaaccaggcagcaaaaggagaactc
ttctgggatgatggtgaatctaaagatactatagaaaagaagatctatatattatatgag
ttttcagtttctaataataacttgattgttaactgcacacattcatcatatccagaggga
aatacccttgtgtttaaaacaatcaaagtccttgggctgagcgccactgtcacagcggtt
acagtgggtgaaaatgatcagcaaatgaaccctcatcttgctttcacttttgatgctttc
aataagattctctcaattacagatctcacattcaacctcggcaaaacctttatagttaga
tggacgacgcaaagtttctcagacaatgagaaattcacttgttatccagatgtaggcaca
gctactgagaaaacttgcgtagagagaggctgcatatgggaaccggtgagcgggctcgcc
aatgtgcctccttgctactttccttcgaaccacaatccctatttgttaacttcaactcaa
aaattggcaacgggcataacagcagaacttcagttgaatcctgcaagtgctagaattaag
cttccatctaatcccatctccactcttcgcgtggaagtaaaatatcacaaaaatgacatg
ctacagtttaagatttacgatgcacatcataagagatacgaagttcctgtaccactaaat
attccagacacccctacaagctctgaggaaaatagactctatgatgtagaaatcaaggaa
aatccttttggcatccaggttcgaaggagaagcactggaaagcttatctgggattcttgc
ctacctggatttgccttcaatgatcaattcattcagatatctacacgtctgccatcacaa
tatttatatggttttggggaagcggaacacacagcattcaagcgaaatttgaattggcat
acttgggggatgttcacaagagatcaacctcctggatataaacttaattcctatggattc
catccgtattacatggctttggaggatgagggcaatgctcatggagtcctgttacagaac
agcaatggaatggatgttacattccagccaacacctgctctaacctaccgcacaattggt
ggaatcttggatttttacatgtttttgggaccaaccccagaaggtgcaacaaagcaatat
catgaagtaattggctttccagtcatgccaccttactgggctctgggattccaactatgt
cgttatggatacagaaatacttcagagattgagcaactgtacaatgacatgaaagctgct
caaatcccctatgatgttcagtatacagacatcaattatatggaaagacaactagacttc
acaattggtgaacgattcaagactcttcctcagtttgttgaaaaaataagaaaagaggga
atgaaatatattgttatactggatccagcaatttcaggaaatgaaacccagccttatcct
gccttcgaaagaggaatacagaaagatgtttttgtcaaatggcctaacacaaatgacatt
tgctgggcaaaggtttggccagatttacctaatattacaatagatgagactataacagaa
gatgaagctgttaacgcttccagagcacatgtagcttttccagacttctttaggaattcc
acatcagagtggtggacaagagaaatttatgacttctacaatgaaaaaatgaagtttgat
ggcttgtggattgacatgaatgagccttccagctttgtaaatggaaccgttacaaataaa
tgcagaaatgatacactaaattatccaccttattttccagaactcacaaaaagaaatgag
gggttacatttccgaaccatgtgcatggaaacagaacatatccttagtgatggatcatca
gttttgcattatgatgtgcacaatttatatggatggtcacaagttaaacccactctggat
gcattacggaacaccactggccttcgagggatagtcatttctcggtccacatatcccaca
gctggtcgatggggaggacactggttgggagacaactatgcaaactgggagaatttggaa
aaatcactcattggtatgctggaatttaatctttttggaataccatatgttggagcagat
atctgtggtttctttaatgactcagaataccacctctgtgctcgttggatgcaagttgga
gccttttatccatattcaagaaatcacaacattcaatttactagaaggcaagatcctgtt
tcctggaatgaaacttttgctcaaatgtcaaagaaagttttagaaatcagatacacattg
ctgccctatttctacacacagatgcatgaagcccatattcatggtggaactgtcatcaga
cccctaatgcatgagttctttgatgataaagaaacctgggaaatatacaagcagttcctg
tggggtccagcttttatggtgactcctgtcattggacctttccagacagctgtgaatggc
tatgttcctaaggctcgatggtttgactaccatacaggggaagacataaaggtcagagga
aaacttcaaacattttcagctccttttgatacaataaatctacatgtccggggaggttat
attctcccatgtcaagaaccggcacagaacacatattacagtcgacagaaatacatgaaa
ctcatcgtagctgcagatgacaaccaaacagcaaaaggaactctattctgggatgatgga
gagtcgatagacacatatgaaaaaaatcaatataccttgatagaattcaatttaaatcag
aaaaatttaacaagtactgtattgaaagatggatatagaaacaaaagtgagatgaaactt
ggaagtatctatgtatggggaaaaggaacaaccagtatcagtcaggttaatctgacttat
ggtgggaatgaacaacagctttcatttactcaagacgaagctaaggagatactaacaatt
gacctgaaaaatgtaactgttactcttgatgaaccaatacaaatcagctggtcatga

DBGET integrated database retrieval system