KEGG   Mus musculus (mouse): 70025Help
Entry
70025             CDS       T01002                                 

Gene name
Acot7, 2410041A17Rik, Ach1, Act, Bach, CTE-IIa, Cte-II, Lach1
Definition
(RefSeq) acyl-CoA thioesterase 7
  KO
K17360  acyl-coenzyme A thioesterase 7 [EC:3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    70025 (Acot7)
   01040 Biosynthesis of unsaturated fatty acids
    70025 (Acot7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    70025 (Acot7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    70025 (Acot7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     70025 (Acot7)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   70025 (Acot7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   70025 (Acot7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 4HBT tRNA_anti-codon NINJA_B TBCC
Motif
Other DBs
NCBI-GeneID: 70025
NCBI-ProteinID: NP_001139529
MGI: 1917275
Ensembl: ENSMUSG00000028937
Vega: OTTMUSG00000010306
UniProt: Q91V12 E9PYH2
Structure
PDB: 

Position
4; 4 E2
AA seq 381 aa AA seqDB search
MKLLVGTLRLWEVGRQVAFSSLTPGQECSGLRKTFWAAMRAVRTRADHQKLGHCVTMGRI
MRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIG
EVAHVSAEITYTSKHSVEVQVHVMSENILTGTKKLTNKATLWYVPLSLKNVDKVLEVPPI
VYLRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDC
TLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFT
SNKSMEIEVLVDADPVVDNSQKRYRAASAFFTYVSLNQEGKPMPVPQLVPETEDEKKRFE
EGKGRYLQMKAKRQGHTEPQP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctggtcgggactctgcgcctctgggaggtggggaggcaggtagccttttcg
agcctgacgcctggccaggagtgttcggggctcaggaaaacattctgggctgccatgagg
gctgtcagaaccagagcagatcaccaaaagcttggacattgcgtcaccatgggaaggatc
atgcgtccagatgatgccaatgtggctggcaatgttcatggagggaccattctgaagatg
attgaggaggccggggccatcatcagcacgcggcactgtaacagccagaatggggagcgc
tgtgtggctgccctggcacgggtggagcgcactgacttcctgtcacccatgtgcatcggc
gaggtggctcatgtcagtgcagagatcacctacacttccaagcactctgtggaggtccag
gtccacgtgatgtcggagaacatcctcacaggtaccaaaaagctgaccaataaagccacc
ttgtggtatgtgcccctgtcattgaagaatgtggacaaggtccttgaggtgcctcccatt
gtgtatttacggcaggagcaggaggaggagggtcggaaacgctatgaagcccagaagctg
gaacgcatggagaccaagtggaggaacggagacattgtccagcctgtcctgaacccagag
ccgaacacggtgagctacagccagtccagcctgatccacctggtggggccctcggactgc
acccttcatggcttcgtgcacggaggtgtcaccatgaagctcatggatgaggtggctggg
attgtggctgcacgccactgcaagaccaacatagtaactgcctctgtggatgccatcaat
ttccacgacaagatccggaaaggctgtgtcatcaccatctccggacgcatgaccttcaca
agcaataagtccatggagattgaggtcctggtggacgctgaccctgtggtggacaactca
caaaagcgctaccgggccgccagtgccttcttcacctacgtgtccctgaaccaggagggc
aagccaatgcctgtgcctcagcttgtgccagagacggaggatgagaagaagcgcttcgaa
gaaggcaaaggccgttatctgcagatgaaggcgaagcgacagggccacacagagcctcag
ccctag

DBGET integrated database retrieval system