KEGG   Mus musculus (house mouse): 70061
Entry
70061             CDS       T01002                                 
Symbol
Sdr9c7, 1810054F20Rik, Rdh20, Rdhs, SDR-O, Sdro
Name
(RefSeq) 4short chain dehydrogenase/reductase family 9C, member 7
  KO
K24425  short-chain dehydrogenase/reductase family 9C member 7 [EC:1.1.1.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    70061 (Sdr9c7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     70061 (Sdr9c7)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Wax2_C
Other DBs
NCBI-GeneID: 70061
NCBI-ProteinID: NP_081577
MGI: 1917311
Ensembl: ENSMUSG00000040127
UniProt: Q8K3P0
Position
10:127734404..127747630
AA seq 313 aa
MAALTDFAFMYRWFKNCNLVKNLSEKYVFITGCDSGFGNLLAKQLVDRGMKVLAACLTEE
GAQKLLQDTSHQLQTFLLDVTKSENVKEAAQWVRDQVGEQGLWALVNNAGVGLPSGPNEW
LTIKDFVKVININLVGLIDVTLNMLPMIKKARGRVVNMSSSGGRVAIFGGGYCVSKFGVE
AFSDSIRRELHFFGVKVSIIEPGNYKTSILGQEALESRMKKLWDRLPQETRDSYGEEYFQ
TYTKKLVNLMRSAEPRISDVTNSMEHAIVSRSPRIRYNPGLDVKFLYLTLAKLPTPVTDF
ILSRYLPRPADSV
NT seq 942 nt   +upstreamnt  +downstreamnt
atggcggccctcacagactttgcttttatgtaccgctggttcaaaaattgcaatctggtt
aaaaacctctctgagaagtatgtcttcatcactggctgtgactccggctttgggaacctg
ttggccaaacaactggttgataggggcatgaaagtgcttgctgcctgcctcactgaggag
ggggctcagaaactcctgcaggacacctcccaccagctgcagaccttcctcctagatgtc
accaagtcggagaacgtcaaggaagcagcccagtgggtgagggaccaagtgggcgagcaa
ggcctctgggccctggtgaacaacgctggcgtgggcctgcccagtggtcccaacgaatgg
ctgaccataaaagactttgtgaaagtgatcaacataaacctggtggggctgattgatgtc
actctgaacatgctgccgatgatcaagaaagcccggggcagggtggtcaacatgtccagc
tctggtggccgtgtggctatattcggcggtggttactgtgtctccaagtttggtgttgaa
gccttctctgatagcatcaggcgcgagcttcatttcttcggggtgaaggtcagcatcatt
gagccagggaactacaagacatccattctgggccaagaagctctggaatcacgcatgaag
aagctgtgggatcggctgccacaggagacccgggatagctacggagaggagtatttccaa
acctatactaaaaagttggttaacttgatgaggtcagcagagccaagaatcagcgatgtc
accaacagcatggagcacgccattgtctcccggagcccccgaatccgctacaaccctggc
ctggacgtcaagtttctctatctcaccctggctaagctgcccacccctgtgacagatttc
atccttagcagatacttgccaagaccagcagacagtgtttga

DBGET integrated database retrieval system