KEGG   Mus musculus (mouse): 70086
Entry
70086             CDS       T01002                                 

Symbol
Cysltr2, 2300001H05Rik, CYSLT2R, Cltr2, Cyslt2
Name
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    70086 (Cysltr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    70086 (Cysltr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    70086 (Cysltr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Cysteinyl leukotriene
    70086 (Cysltr2)
SSDB
Motif
Pfam: 7tm_1 TAS2R 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 70086
NCBI-ProteinID: NP_001155884
MGI: 1917336
Ensembl: ENSMUSG00000033470
UniProt: Q920A1
Position
14; 14 D3
AA seq 309 aa
MEVTGTPSSYSNRNCTIENFKKEFYPIIYLIIFFWGALGNGFSIYVFLQTCKKSTSVNVF
MLNLATSDFLFISTLPFRADYYFRGSNWIFGDLACRVMSYSLYVNMYTSIYFLTVLSVVR
FLATVHPFRMFHVTSVRSAWILCGIIWVFIMASSALLLVNGQEEKDNIISCLELSPQKFK
SLLIMNHIAVAVGFLLPFLTLTVCYLLIIRILLKAEIPESGPRAAHRKALTTIVIAMITF
LLCFLPYHALRTLHLVTWDKDSCGDVLHKATVITLTMAAANSCFNPFLYYFAGENFKARL
RAIFSKVHL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaagtaactgggacccccagcagttatagtaacaggaactgtacaatagaaaacttt
aagaaggaattttaccccatcatatacctgataatatttttctggggagccttgggaaat
ggcttttccatatatgtctttctacagacttgcaagaagtccacatctgtaaatgttttc
atgctcaacctggccacttccgattttctattcatcagcaccttgcccttcagggctgac
tattatttcagaggttccaattggatatttggggacttggcctgcagagtcatgtcttat
tccttatatgtcaacatgtatactagcatttatttcctaactgtgctgagtgtggtgcgt
ttcctggccacagtccaccccttccggatgttccatgtcaccagtgtcaggagtgcctgg
atcctctgtgggatcatatgggttttcatcatggcttcctcagccctgcttctggtgaac
ggccaagaggagaaagataacattatatcatgcttggagctgagtcctcaaaagtttaaa
agtctcctgatcatgaaccacattgcagtagcggtaggcttcttgctcccatttctcacg
ctcaccgtctgctacctgctgatcatccggatcttgttaaaggctgagattccagaatca
ggtccacgtgctgctcataggaaggcgctgaccaccattgtcattgccatgatcaccttc
ctcctctgttttctgccataccatgcactgcggaccctccacttggtcacatgggataaa
gattcatgtggggatgtgctacataaggccacagtcatcacactgaccatggctgcagcc
aatagctgcttcaatccctttctctattattttgctggggagaatttcaaagctcgatta
agggctatattcagcaaagttcatctatag

DBGET integrated database retrieval system