KEGG   Mus musculus (house mouse): 70097
Entry
70097             CDS       T01002                                 
Symbol
Sash1, 1100001C18Rik, 2500002E12Rik, A330076K04Rik, mKIAA0790
Name
(RefSeq) SAM and SH3 domain containing 1
  KO
K23705  SAM and SH3 domain-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    70097 (Sash1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   70097 (Sash1)
SSDB
Motif
Pfam: SLY SAM_2 SAM_1 SH3_2 SH3_1 DUF6325
Other DBs
NCBI-GeneID: 70097
NCBI-ProteinID: NP_780364
MGI: 1917347
Ensembl: ENSMUSG00000015305
UniProt: P59808 F8VQK5
Position
10:complement(8597981..8821290)
AA seq 1230 aa
MEEDAGAASPAPEPEPEVDPARELEPEAGVSESISRLWTDVMGILDGSLGNIDDLAQQYA
DYYNTCFSDVCERMEELRKRRVSQDLDVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVE
RKYPLHKSNSEDGCVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDE
ERIQLMMMVKEKMITIEEALARLKEYEAQHRQSSTLDPADWPDGSYPTLDGSSTCNSREQ
SDDETEDSVKFKRLHKLVNSTRRVRKKLIRVEEMKKPSTEGGEEHVFENSPVQDERSALY
SGVHKKPFFYDGSPEKPPEDDADSLTPSPSSSSLDTWGAGRKLVKTFSKGESRGLIKPPK
KMGTFFSYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHVGSNNSDP
AGKEGDFVYKEVIKSPPAPRISLGKKVRSVKETMRKRMSKKYSSPVSEQDSGLDGMPSSP
ASGKPDSEHVDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDE
EPPYRGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKF
IYVDVLNEEEEKPKRPTRRRKKGRPSQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKL
LEEEDLDELNIRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDNQGLSGRSPRDSGC
YESSENLENAKTHKPSVLSTKSSTESNLKSFTRSQPGNYPTLPLMKSGEVRKQGEEGRLG
RGLAPDTAKSCDVPSVTDLSKNRRSLPVSICRSCETLEGPEPVESWPRSHSLDDLQGDAD
VGKNVPTEMPETCSQNVPEVPQKTSACTSKALPRGRDPTADVMLLTQSKRFSDPPKTMAK
KLDGSVVASNLGIAPPQCIPRDFEAQPPVKPGLTRTSLEGLRKGHDHHPLGTKEGVDGEQ
SAPETRTQSRHPSQPPPVPAKKSRERLANGLHLVPSPEAPILPLKKASPASPVSPSDCPS
PREPRPSSGTEPGSPACTRPPPWLAELPESTSLQEHGVKLGPVLSRKVSCVRGVDLEMLT
ENKLQAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLEQPERDVATNMDQIRVKLLRKQH
RMAIPSGGLTEICRKPLSPGCVASMSDWLISIGLPMYTSTLSDAGFSTLSQVPSLSHSCL
QEAGITEERHIRKLITAARLFKLPPSPEAM
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggaggaggacgcgggagctgctagcccggcgccggagcctgagccggaggtggatccc
gcccgggagctggagcccgaggccggtgtctccgagtcaatctcccgcctctggaccgac
gtgatgggcatcctggatggttccctgggaaacattgatgacctggcacagcagtatgca
gattattacaatacctgcttttctgacgtgtgtgagcggatggaggagctccggaaacgg
cgcgtttcccaggacctggatgtggagaaacccgacgccagccccacgtcacttcagctg
cggtcccagatcgaagagtctctaggcttctgcagcgccgtgtcaacaccagaagtggaa
agaaagtaccctctccataaatcaaactcagaagacggctgtgtaggcaaaggagattgg
aagaagaaaaataaatacttctggcagaatttccgaaagaaccaaaaaggaataatgaga
cagacttcaaaaggagaagatgtgggctatgtagccagcgagattacgatgagtgacgag
gagcggattcagctgatgatgatggtcaaggagaaaatgatcaccattgaagaagcgctc
gccaggctgaaggaatacgaggcccagcaccgtcagtcatccaccttggaccccgcagac
tggcccgatggctcctacccgacattggatggctcctccacctgcaactcaagagagcag
tcggatgatgagacagaggactcggtgaagtttaagaggttgcacaagctggtaaactct
actcgaagagtcagaaagaaactaattagggtggaagaaatgaaaaagcccagcacagaa
ggtggagaggaacatgtatttgagaattccccagtccaagatgaaagatctgcactctac
tctggagtgcacaaaaagccatttttctatgatggctctcctgagaaacctccagaagat
gatgcagactctctcaccccatctccatcatccagcagcctggatacgtggggagctggc
cggaagttggtcaaaaccttcagcaaaggagagagtcggggcctgattaagccccctaag
aagatggggacattcttctcctatccagaagaagagaaggcccagaaagtgtcccgctcc
ctcacagagggggaaatgaagaaaggtcttgggtctttgagtcacgggagaacctgcagt
tttggtggattcgacctgacaaaccgttctctgcatgttggcagtaataattctgaccct
gcgggtaaagagggagattttgtgtacaaagaagtcatcaaatcccctcctgccccccgc
atctctctcgggaaaaaggtgagatcagtgaaagagaccatgaggaagaggatgtctaaa
aagtacagcagcccggtctcagagcaggactcggggctcgatggaatgcccagctccccc
gcctcaggaaagcctgactccgaacacgtggacaagcctaagctcaaagccgggggctct
gtggaaagccttcggagttctctgagtggccagagctcaatgagtggtcagacagtgagc
accactgattcctccaccagcaaccgggagagtgtcaagtcagaagatggggatgacgaa
gagccaccctatcggggtcccttctgtgggcgtgcccgagtgcacactgacttcaccccc
agtccctatgacacggactctctgaagctcaagaaaggagatatcattgacataattagc
aaaccacccatgggtacctggatgggcctgctgaacaacaaagtcggcacgttcaagttc
atctacgtggatgtgctaaatgaggaagaggagaagcccaagcgccctaccaggaggagg
aagaagggaagaccatctcagccgaagtctgtggaggatctcctggaccggatcaacctg
aaagaacacatgcccaccttcctgttcaatggctatgaagacctggacaccttcaaactc
ctggaggaagaagacttagatgaattaaatatcagggacccagaacacagagcagttctt
ctgactgcggtggagctgttgcaggaatatgacagtaacagtgaccagtccggttctcag
gaaaagctgctggtggacaaccagggcctgagtggacgatccccacgagactccggatgc
tacgaaagcagcgagaacttggaaaacgccaaaactcacaaacccagcgttctgtctacc
aagtcgtccacggagtccaacttaaagtctttcaccaggagtcagccaggcaactacccg
acattgcctttaatgaaatcaggggaggtgcgcaagcagggagaggagggcaggctggga
cgaggtctagccccggacactgccaagagctgtgacgtgccctctgtgactgatttgagt
aaaaaccgaaggagcctcccggtctccatctgtcgcagctgtgaaaccctggagggtcct
gagcctgtggaaagttggccccgatcccattccctggatgaccttcagggagatgctgat
gttggcaagaatgtgcctaccgagatgccagaaacctgttctcagaatgtaccagaagtg
ccgcagaagacgtctgcctgcacctccaaggctctgccacgaggccgagatcccacagca
gatgtgatgcttctgacccaaagcaagagattttccgaccccccgaaaacaatggctaag
aaactggatggctccgtggtggcctccaaccttgggatagctcctcctcagtgtataccc
agagatttcgaggcccagccgcctgttaaacccggcttaacaaggacgtctcttgagggt
ctcagaaaaggacatgatcaccaccccctgggcaccaaagaaggggtagacggggagcag
agcgcccctgagaccaggacacagtcccgacatccgtcgcagccccctcctgtgccagcc
aagaaaagccgagagcgcctggccaatggcctgcacttggtccccagcccagaggcaccc
atcctgccactgaagaaagccagccctgccagcccagtcagtcccagcgactgcccctct
ccccgggaacccaggccttcctccgggactgagccgggcagcccagcctgtacgagacct
ccaccctggctggctgagctgcccgagagcactagcctgcaggagcatggtgtgaaactg
ggcccagtgctgagcaggaaggtttcctgtgtccggggtgtggacctagagatgctcacg
gagaacaagctgcaggcggagggcattgatctcactgaggagccctactctgataagcat
ggccgttgtgggatcccggaagccctggtacagagatacgcagaggacctagagcagcct
gagagggatgttgccaccaacatggaccagatccgggtgaagctgcttcggaagcaacat
cggatggcgatcccgagtggtgggctgacggaaatctgcagaaagcccctctctcccggc
tgtgttgcgtccatgtcggattggctcatctctatcggcctgcccatgtacacgagcacc
ctttctgacgcagggttcagcacgctgagccaagtgccttccctgtcccactcttgcctt
caggaggccggcatcaccgaggagagacacataaggaaactcataacggcagccagactc
ttcaaactgccaccaagccctgaggctatgtag

DBGET integrated database retrieval system