KEGG   Mus musculus (mouse): 70113
Entry
70113             CDS       T01002                                 

Gene name
Odf3b, 2010001J22Rik
Definition
(RefSeq) outer dense fiber of sperm tails 3B
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: SHIPPO-rpt
Other DBs
NCBI-GeneID: 70113
NCBI-ProteinID: NP_001013040
MGI: 1917363
Ensembl: ENSMUSG00000047394
UniProt: Q5M8M2
Position
15; 15 E3
AA seq 238 aa
MGSEVWVGTWRPHRPRGPIAALYRGPGPKYKLPTNTGYKLHDPSRPRAPAFSFGSRPPLR
HATCGPGPSYLVPARMTVRGTVGSPAFSIYGRLSHTAPVLTPGPGRYYPERARNVTYPSA
PRHTIAPRNWGILAKQETPGPGSYTVPSLLGSRVISKVSAPTYSIYSRSPVGSCFEDLSK
TPGPCAYHVVNPMIYKTRAPQFTMLGRTLPPRENTKKPGPASYSVDKVVWSRGSRGRG
NT seq 717 nt   +upstreamnt  +downstreamnt
atgggctcagaagtctgggtcggcacttggcggccacatcggccccgcggccccatcgcg
gcgctctacagaggcccggggccaaaatacaagctgccaacgaacaccggttacaaactg
cacgacccgtctcggccgcgagcccccgccttctccttcggctcgcgtccacccttgcgg
catgcaacctgcggacccgggccgagttacctggtgcctgctcgcatgactgtgcgcggc
acagttggctccccggccttctccatctacggtcgcctaagccacacggcgcctgtcctc
actccgggaccgggcaggtactacccagaacgcgcgagaaatgtgacgtaccccagcgct
cctcggcataccatcgctccccgaaactggggcatcctcgcaaagcaagaaaccccaggc
cctgggtcctacaccgtgccttcgctcttgggctcacgagtcataagcaaagtctcagcc
ccaacttactccatctacagccgcagccctgtgggcagctgcttcgaggacctcagcaag
accccaggcccttgtgcctaccacgtagtgaatcctatgatctacaagactcgagccccg
cagttcacgatgctggggaggactctgccaccccgagagaacaccaagaagccaggacct
gcatcctacagcgtggacaaggtggtctggagtcgagggtcaaggggcaggggatga

DBGET integrated database retrieval system