KEGG   Mus musculus (mouse): 70120
Entry
70120             CDS       T01002                                 

Gene name
Yars2, 2210023C10Rik, tyrRS
Definition
(RefSeq) tyrosyl-tRNA synthetase 2 (mitochondrial)
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    70120 (Yars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    70120 (Yars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    70120 (Yars2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    70120 (Yars2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     70120 (Yars2)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   70120 (Yars2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    70120 (Yars2)
 Prokaryotic type
    70120 (Yars2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    70120 (Yars2)
SSDB
Motif
Pfam: tRNA-synt_1b S4
Other DBs
NCBI-GeneID: 70120
NCBI-ProteinID: NP_937889
MGI: 1917370
Ensembl: ENSMUSG00000022792
Vega: OTTMUSG00000026531
UniProt: Q8BYL4 Q8BJJ2
Position
16; 16 A2
AA seq 472 aa
MAAPMLRRLCRVPQSLVWLRGSRAVRPGARGMLVAPRARGLFKEFFPESGTKTELPELFD
RRRAGSSPQTVYCGFDPTGDSLHVGHLLTLLGLFHFQRAGHNVIALVGGSTALLGDPSGR
TKGREALSAECVRANAHALRRGLEALAANHARLFADGRPWGSFTVLDNAAWFQEQHLVDF
LATVGGHFRMGTLLSRLSVQSRLKSPEGMSLAEFFYQVLQAYDFYYLFQHYGCRVQLGGS
DQLGNIMSGYEFIHKLTGEDVFGITVPLITSTTGAKLGKSAGNAVWLNREKTSPFELYQF
FVRQQDDSVERYLKLFTFLPLPEIDHIMQLHVKEPEKRVAQKRLAAEVTKLVHGQEGLDS
AKRCTQALYHSSIEALEVMSDQELKELFKEASFSELVLDPGTSVIDTCRKANAIPDGPRG
YRMITEGGVSINHRQVTNPESVLVIGQHILKNGLSLLKIGKRNFYIIKWLQL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcggcgcccatgctgaggcgcctgtgccgcgttccgcagtccctggtctggctacga
gggtcgcgtgcggtgcgcccgggcgcgcggggaatgctggtggcaccgagggcccgcggc
ttgttcaaggagttcttccccgagagcggcacgaagacagagctccccgaactctttgac
cgccgcagggcgggctcgtccccccagacggtgtactgcggcttcgaccccacgggcgac
tcgctccacgtggggcacctgctaactctgttggggctcttccacttccagcgagccggc
cacaacgtgatcgcgctcgtgggaggctccacggccctcctgggggaccccagcggccgg
accaaggggcgcgaggcgctgagcgccgagtgcgtgcgggccaacgcgcacgccctgcgg
cgagggctcgaggccctggcggccaaccacgcgcgcctcttcgcggacggccggccctgg
ggctctttcacggtgctggacaacgcggcctggttccaggagcagcacctggtggatttc
ctggccacggtgggcggccacttccgcatgggcactctgctgagccggctgagcgtgcag
tcgcgtctcaagagccccgagggcatgagcttggcggagttcttttaccaggtgctccag
gcctatgacttctactaccttttccagcactatggatgccgggtccaactgggcggatca
gatcagttgggcaacatcatgtctggctacgagttcatccacaagttgactggagaggat
gtgtttggaatcactgtacctctaattacaagtacaactggagcaaagctgggaaagtct
gctggcaatgcggtttggctaaacagagagaaaacatcaccgtttgaactttatcagttc
tttgtcagacagcaagatgattccgtagaaaggtacctgaagcttttcactttccttccc
ctcccagagatcgatcacatcatgcagctacatgtcaaagaaccagaaaagcgagttgct
cagaaacgacttgctgcagaagtaacaaagcttgttcacggacaagaaggtctggactct
gctaaaaggtgtacacaagccctttaccatagcagcatagaggcactggaggtcatgtct
gaccaagagttaaaagaattgtttaaagaagcttcattttctgaattagttcttgatcct
ggaacgagtgtcatagacacatgccgtaaagcaaatgccattcctgatggccctcgaggg
tatcggatgataacagaaggtggagtcagtataaatcacagacaggtaacaaatcctgaa
agtgttctagtaattggacaacatattctcaagaatggactttccttacttaaaatagga
aaaaggaatttctacattataaaatggcttcagttgtga

DBGET integrated database retrieval system