KEGG   Mus musculus (mouse): 70127
Entry
70127             CDS       T01002                                 

Symbol
Dpf3, 2810403B03Rik, 6530402L11Rik, BAF45C, C78788, CERD, CERD4, Gm18872, cer-d, cer-d4
Name
(RefSeq) D4, zinc and double PHD fingers, family 3
  KO
K22198  BRG1-associated factor 45B/C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    70127 (Dpf3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    70127 (Dpf3)
SSDB
Motif
Pfam: Requiem_N PHD PHD_4 Lar_restr_allev zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-PHD-like
Other DBs
NCBI-GeneID: 70127
NCBI-ProteinID: NP_001254554
MGI: 1917377
Ensembl: ENSMUSG00000021221
Vega: OTTMUSG00000033729
UniProt: P58269
Position
12; 12 D1
AA seq 378 aa
MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKR
HRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEA
LLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDVPKRKNRTRGRARGSA
GGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPN
HRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTL
NMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSC
HLCWELLKEKASAFGCQA
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcgactgtcattcacaaccccctgaaagcgcttggggaccagttctacaaggaagcc
attgagcactgccggagctacaactcgaggctgtgcgcagagcggagcgtgcgtctcccc
ttcctggactcgcagactggggtggctcagaacaactgctacatctggatggagaagagg
caccgcggcccaggcctcgctccgggccagttgtacacataccctgcccgctgctggcgc
aagaagcgacgattgcacccaccagaggacccaaaactacgactcctggaaatcaaaccc
gaagtagaactgcccctgaagaaagatggatttacctctgagagtaccacactggaagcc
ttgcttcgcggcgagggagtagagaagaaggtggatgccagagaagaggaaagcatccag
gagatacagagggttttggaaaatgatgaaaacgtagaagaagggaatgaagaggaggat
ttggaagaagatgttcccaagcgcaagaacaggaccagaggacgggctcgcggctctgca
ggcggaaggaggaggcatgatgccgcctctcaggaagaccacgacaaaccctacgtctgc
gacatctgtggcaagcgctacaagaaccggccaggactcagctaccactacgctcatact
cacctggccagcgaggagggagacgaagcccaagaccaggagacccgatccccacccaac
cacagaaatgagaaccacagaccccagaaaggaccagacgggacagtcattcctaataac
tactgtgacttctgcttggggggctccaacatgaacaagaagagtgggaggcctgaagag
ctggtgtcctgtgcagactgtggacgctctggtcatccaacttgcctgcagttcactctg
aacatgactgaggcagttaagacctacaagtggcagtgcatagagtgtaaatcctgtatc
ctgtgtgggacctcggagaacgacgaccagctactcttctgtgatgactgcgatcgtggc
tatcacatgtactgtttaaatcccccagtggctgagcccccagaaggaagctggagctgc
catttatgctgggagctgctcaaagagaaagcatcagcctttggctgccaggcctag

DBGET integrated database retrieval system