KEGG   Mus musculus (mouse): 70160
Entry
70160             CDS       T01002                                 

Gene name
Vps36, 1700010A24Rik, 2210415M20Rik, 2810408E15Rik, Eap45
Definition
(RefSeq) vacuolar protein sorting 36
  KO
K12190  ESCRT-II complex subunit VPS36
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    70160 (Vps36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    70160 (Vps36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    70160 (Vps36)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    70160 (Vps36)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   70160 (Vps36)
  Exosomal proteins of colorectal cancer cells
   70160 (Vps36)
SSDB
Motif
Pfam: EAP30 Vps36_ESCRT-II GRAM MA3 BBL5 PH_TFIIH
Other DBs
NCBI-GeneID: 70160
NCBI-ProteinID: NP_081614
MGI: 1917410
Ensembl: ENSMUSG00000031479
Vega: OTTMUSG00000027110
UniProt: Q91XD6 Q3TSR1
Structure
PDB: 
2DX5

Position
8; 8 A2
AA seq 386 aa
MDRFVWTSGLLEINETLVIQQRGVRVYDGEEKIKFDAGTLLLSTHRLIWRDQKNNECCMA
IPLSQIVFIEEQAAGIGKSAKIVVHLHPAPSNKEPGPFQSSKNSYIRLSFKEHGQIEFYR
RLSEEMTQRRWETVPVSQSLQTNKGPQPGRVRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKEKQGDVTEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQAPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
IRLRVFDSGVMVIELQTHKEEEMVASALETVSERGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQN
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaccgcttcgtgtggaccagcggcctcctggagatcaacgagaccctggttatccag
cagcgcggggtgcgcgtctacgacggcgaggagaagataaaatttgatgccgggactctt
cttcttagtacacaccggctgatttggagagaccagaagaataatgagtgctgcatggcc
attcccctgtctcagattgtgttcatcgaggagcaggcagctggaatcgggaagagcgcc
aaaatcgtggttcacctgcacccagctccttctaacaaagagcccggtccgttccagagc
agtaagaactcctacatcagactctccttcaaagaacatggccagattgagttttacagg
cgtttatcagaagaaatgacacagagaagatgggagactgtgccagtttcccagtcacta
caaacaaataaaggaccccagccaggaagagtaagagctgttggaattgtaggtattgaa
aggaaacttgaagaaaaaagaaaagaaaccgataaaaacatttctgaggcctttgaagac
ctgagcaagctgatgattaaggctaaggaaatggtggagttatccaaatcaatcgctaat
aagattaaagagaagcaaggcgatgtcacagaggatgagaccatcaggtttaagtcgtac
ctgctgagtatgggaatagccaacccagtcaccagagaaacctatggctccggcacacag
taccacatgcagctggccaaacagctggctggaatattgcaggcacctttggaggagcgt
gggggaataatgtccctcacagaggtgtactgtctagtgaaccgggcccgaggaatggag
ttgctctcgccagaagatttggtaaatgcgtgcaagatgctggaagcgctaaaattgcct
atcaggcttcgggtttttgacagtggtgtcatggtaattgagcttcaaactcacaaggaa
gaggaaatggtggcctcggccctggagacggtttcagaaagggggtccttaacatccgaa
gagtttgccaagcttgtgggaatgtctgtccttctggctaaagaaaggctgctccttgca
gagaagatgggccacctttgccgagacgactccgtggaaggcttgcggttttatccaaat
ttatttatgacacagaactaa

DBGET integrated database retrieval system