KEGG   Mus musculus (house mouse): 70163
Entry
70163             CDS       T01002                                 
Symbol
Lypd8, 2210415F13Rik
Name
(RefSeq) LY6/PLAUR domain containing 8
  KO
K25371  Ly-6/uPAR domain-containing protein 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    70163 (Lypd8)
SSDB
Motif
Pfam: UPAR_LY6 DUF5330 DUF5998
Other DBs
NCBI-GeneID: 70163
NCBI-ProteinID: NP_001077353
MGI: 1917413
Ensembl: ENSMUSG00000013643
UniProt: Q9D7S0
Position
11:58269858..58281367
AA seq 255 aa
MRGVFIAGVIAAFAITVVDSLNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFL
HVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQ
CMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNT
TVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASF
TSSIFGSLLLLKLLF
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagaggcgtcttcatcgctggtgtcattgcggcattcgccatcacagttgtagactcc
ctgaattgtacacagtgttatacgtacaatagcacctgtgatggccaggccactgaatgc
aatgagcagtccttcagttgtgtggagtcctctatcaactccactctaggagggttcctg
catgtgtaccagaacaagttctgctccgcatcgaattgcaccgagaacagcacggaggtg
gccttcactgtccatctatttgatgaccaaagataccattttgcaagccagtgctgccaa
ggagagtcctgcaatgccacccactctgaatccggaacacagaatgtaactgacatgcag
tgcatgtcttgctatggtcacaacaaaacactctgcgaggagaaaccccaaaagtgttac
gaaggagaacaatgtgtcttcatcattgcggagatggtaaatggctctggcagagtggag
ctgaagggctgttctgatatcagcaactctacttgtcaattcctgtcccctgggaacaca
acagttggagagtttgttttcaagtcggttgaatgtacgcaacccactgagtataccaac
tcgaccaccactatcccaccaatcaccaacacttccctcacctctgttacccgaccaggc
atcaaaacttcccccgcctctgttaccccacaggctagcatgggcaccaaagcttccttc
acctcctctatcttcggcagccttcttcttctgaagctgctgttctga

DBGET integrated database retrieval system