KEGG   Mus musculus (house mouse): 70207
Entry
70207             CDS       T01002                                 
Symbol
Taco1, 2310066I18Rik, Ccdc44
Name
(RefSeq) translational activator of mitochondrially encoded cytochrome c oxidase I
  KO
K18189  translational activator of cytochrome c oxidase 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    70207 (Taco1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    70207 (Taco1)
SSDB
Motif
Pfam: Transcrip_reg
Other DBs
NCBI-GeneID: 70207
NCBI-ProteinID: NP_081622
MGI: 1917457
Ensembl: ENSMUSG00000001983
UniProt: Q8K0Z7
Structure
Position
11:105956885..105964861
AA seq 294 aa
MMSWAAASLRMTAVPCFRVRCLGFRVGPWGASQHANPGCGAAPHRTLHVSATASAGHNKW
SKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNSSLANILELCRSKNMPKSTIE
SALKTEKNKGIYLLYEGRGPGGSSLLIEALSNSGPKCHLDIKYILNKNGGMMAEGARHFF
DKKGVVVVGVEDREKKAVNLERALELAIEAGAEDVKEAEDEEEKNLFKFICDASSLHQVR
KKLDSLGLCPVSCSMEFIPHSKVQLAEPELEQAAHLIQALNNYEDVIHVYDNIE
NT seq 885 nt   +upstreamnt  +downstreamnt
atgatgtcttgggctgccgccagcctgagaatgaccgctgtcccgtgctttcgtgtgcga
tgcctcgggttccgcgtgggtccttggggcgcctcccagcatgcaaaccccggctgtggt
gcagcgccacacaggacgctgcatgtcagcgcgacggcctcggcgggacacaataagtgg
tctaaagtccggcacatcaagggccccaaggacatggaaaggagtcgaatcttctctaaa
ctcactctcagtatccgcctggcggttaaagagggaggccctaaccctgagaacaacagc
agcctggccaacatcttagagttgtgtcgcagcaagaatatgcccaagtcaaccatcgag
tcagcactgaagacagagaaaaacaagggcatttatttgctatatgagggtcgtggccct
ggaggctcttctctgctcattgaggcgttatcaaacagtggtcccaagtgccatctggac
attaaatatatcctgaacaagaatgggggaatgatggctgaaggagcacgccactttttt
gacaaaaaaggagtggttgttgttggagtggaggacagagagaagaaagctgtgaaccta
gagcgtgccctagaactggccatcgaagcaggagccgaggatgtgaaggaagccgaagac
gaagaagaaaagaacctttttaaattcatttgtgatgcttcttcactacatcaagtgagg
aaaaaactggactcgctgggcctgtgtcctgtgtcctgttcaatggagttcatccctcac
tccaaggtgcagctggctgagccggagctggagcaggctgctcacctcatccaggcgctt
aacaactatgaggatgtgattcacgtttatgacaatattgaataa

DBGET integrated database retrieval system