KEGG   Mus musculus (house mouse): 70223
Entry
70223             CDS       T01002                                 
Symbol
Nars, 3010001M15Rik, AA960128, ASNRS, C78150, NARS1
Name
(RefSeq) asparaginyl-tRNA synthetase
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    70223 (Nars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    70223 (Nars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    70223 (Nars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     70223 (Nars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   70223 (Nars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    70223 (Nars)
 Prokaryotic type
    70223 (Nars)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Other DBs
NCBI-GeneID: 70223
NCBI-ProteinID: NP_001136422
MGI: 1917473
Ensembl: ENSMUSG00000024587
UniProt: Q8BP47
Position
18:complement(64632726..64649586)
AA seq 548 aa
MVLAELYVSDREGNDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWDVISK
SQMKNIKKMWHREQMKNDSREKKEAEDNLRREKNLEEAKKIIIKNDPSLPEPACVKISAL
EGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLSDDLCQCYNGVVLSTESSVA
VYGTLNLTPKGKQAPGGHELSCDFWELVGLAPAGGADNLINEESDVDVQLNNRHMMIRGE
NMSKILKARSMITRCFRDHFFDRGYCEVTTPTLVQTQVEGGATLFKLDYFGEEAFLTQSS
QLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEFTHVEAECPFLTFEDLLNRLEDLVCD
VVDRVLKSPVASIVYELNPNFKPPKRPFRRMNYSDAIEWLKEHDVKKEDGTFYEFGDDIP
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDPRLTESVDVLMPNVGEIVGGSMRSW
DSEEILEGYKREGIDPAPYYWYTDQRKYGTCPHGGYGLGLERFLSWILNRYHIRDVCLYP
RFLQRCRP
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggttctagcagagctgtatgtatctgaccgagaaggaaatgacgcaaccggggatgga
accaaggagaaaccatttaaaacaggcctaaaggctttgatgacagttggaaaagagcca
tttcccaccatttatgtggactcacaaaaggaaaatgagagatgggatgttatttctaag
tcacagatgaagaacattaaaaagatgtggcacagagaacagatgaagaacgactctagg
gagaagaaagaggcagaagataacttacgaagagaaaagaacctggaggaagcaaaaaaa
attattattaaaaatgacccgagcctgccagagccggcctgtgtaaagattagtgcatta
gaaggatacagaggccagagagtgaaggtgtttggctgggtccacaggttgcgcaggcaa
ggaaagaatttgatgtttttggtgttgcgagatggtacgggttatcttcagtgtgtcttg
tcagatgacttgtgtcagtgttacaatggagtagtcctgtccaccgagagtagtgtggcg
gtgtacggaacactaaacctaactccaaagggcaaacaggctccaggaggccatgagctg
agctgtgacttctgggaactggtggggctggccccggctggaggagctgataacctgatc
aacgaggagtctgatgtggatgtccagctcaacaaccggcacatgatgatccggggagag
aacatgtccaaaatcctgaaagcgcgctccatgatcaccaggtgtttccgggaccacttc
ttcgacaggggctactgtgaagttaccactccaacactggtgcagacgcaggtggaaggt
ggggccacgctcttcaagcttgactatttcggggaagaagcgtttttgacccagtcctca
cagttgtacctggagacctgccttccagccctgggagatgttttttgtatagcccagtca
tacagggccgaacagtccaggacacgaaggcacctggctgagttcactcacgtggaagct
gagtgtcctttcctgaccttcgaggacctcctgaaccgtttagaggacctagtgtgtgat
gtggtggacagagtcctgaagtcaccagtggcaagcatagtgtatgagctcaacccgaac
tttaaaccccccaagcggcctttccgcaggatgaactactcggatgctattgagtggctg
aaggagcatgatgtcaagaaagaagacgggactttctacgagtttggagatgatattccc
gaagcgcctgagagactgatgacagacaccattaatgaaccaatcctgctgtgtcgcttt
cctgtggagatcaagtctttctatatgcagcgctgtcctgaggatcctcgacttactgaa
tctgtggacgtgttgatgcccaacgttggtgagattgtaggtggctcgatgcgctcctgg
gacagtgaggagattctcgaaggctataagagggaagggattgaccccgctccttactac
tggtatacagatcagagaaaatatggcacctgtcctcatggagggtatggcttgggcttg
gaacgatttcttagctggattctgaacaggtatcacatccgagatgtgtgcctgtaccct
cgatttctccagcgctgcaggccataa

DBGET integrated database retrieval system