KEGG   Mus musculus (mouse): 70237Help
Entry
70237             CDS       T01002                                 

Gene name
Bhlhb9, 2700087I09Rik
Definition
(RefSeq) basic helix-loop-helix domain containing, class B9
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm_2
Motif
Other DBs
NCBI-GeneID: 70237
NCBI-ProteinID: NP_001091692
MGI: 1917487
Ensembl: ENSMUSG00000072964
Vega: OTTMUSG00000018769
UniProt: Q6PB60
Position
X; X F1
AA seq 539 aa AA seqDB search
MTGSKNKARAQAKLEKRASAQARAVAEREAANANRGAGKSRDKGKGKAGSKSDAVAEVKA
GSKGKVVAETKEGARPESKALVKGTSDFNHRTENKFARSTRKDKPSSDNWFWAGEDSGIN
SWFWKGEELSNNSVAKCENKPSTSIQARAEEPAPRTSHKSRSGAEEEEEENVIGNWFWEG
DDTGFDTDPKPVFKIVKPQPVDEINEKDRPKDWSEVTIWPKAPAVTPAVLGYRSQDSSEA
RSSSYIVLASNEEETSTACTKNTRSSLQSIPEYPFGSDPCIQTLDEIRQQIKIREENGIK
PFACPCKLECYLDSPEFEKLVNILKSTTDPLIHKIAQIAMGIHKVHPFAQEFINEVGVVT
LIESLLSFSSPEVSIKKAVITLNSSGDDRYNKVEFHVKHMCKETVSFPLNSPGQQSGLKI
IGQLTTESVHHYIVVSYFSELFHLLSQGNRKTRNLVLKVFLNMSENPKAARDMINMKALA
ALKLIFNQKEAKANLVSAVAIFINIKEHIRKGSIVVVDHLSYNTLTAIFREVKGIIERM
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcaaagaataaggctagggcacaggctaaactagaaaaaagggcaagtgca
caagccagagctgtggcagagagggaggctgctaatgccaaccgaggtgcaggcaaaagc
cgggacaaagggaaaggtaaggcaggctctaaatcagatgcagtggcagaggtgaaggca
gggtctaagggaaaggtagttgctgagacaaaagaaggagcgagaccagaatctaaggct
ctagtaaaaggcacctcagatttcaaccataggactgagaacaagtttgctagatccaca
cgtaaagataagcccagtagtgataactggttctgggctggagaagattctggtattaat
tcctggttctggaagggagaagagcttagtaataattctgttgctaagtgtgaaaataaa
cctagtactagtatccaggctcgtgctgaggagcccgcacctaggaccagccacaagtct
aggtcaggtgctgaggaggaggaggaagagaacgttattgggaactggttttgggaaggc
gatgacactggttttgatactgatcctaaacctgtgttcaaaatagttaaacctcagcca
gtggatgaaattaatgaaaaagataggccaaaggactggtccgaggtaactatatggccc
aaagctcctgctgtaactccagcagtgttaggttatagatcccaggattcatctgaggca
aggtcctcttcatacattgttctggcctcaaatgaagaggaaacttcaacagcctgtact
aagaatactcgttcaagcctacagtctatacctgagtatccatttggttctgatccttgc
atccagaccttagatgaaattagacagcaaatcaagatcagagaagagaatggcatcaag
cccttcgcttgcccttgcaaactggagtgctatttggattctccagaatttgaaaagctt
gttaacatacttaagtcaactactgatcctcttattcataaaatagcacagattgcaatg
ggtatacataaggttcatccatttgcccaggaattcattaatgaagtgggcgtggtgaca
cttattgaaagcttgctcagtttttcttcccctgaggttagtattaaaaaggctgtgatt
actctgaactcttccggggatgacagatacaacaaggtagagtttcatgttaagcatatg
tgtaaagaaactgtgtccttccccttgaactcacctggccagcaatctggattaaagata
atagggcagctgactaccgagtctgtccatcactacattgtagtcagctacttttcagag
cttttccatttgctgtctcagggaaatcgtaagactaggaatcttgttttgaaagtattt
ttgaatatgtctgaaaatcccaaggcagccagagatatgataaatatgaaggcgttagca
gcattaaaactcatctttaaccaaaaagaggcaaaagccaatcttgttagtgctgtggcc
atctttattaacataaaggagcatattagaaagggttcaattgtagtagtcgatcacttg
agttacaatactcttacagccatattccgtgaagttaaggggattatcgaaagaatgtaa

DBGET integrated database retrieval system